Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|639450
Gene name
Locationscaffold_05a:569241..571549
Strand-
Gene length (bp)2308
Transcript length (bp)1839
Coding sequence length (bp)1839
Protein length (aa) 613

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08616 SPA Stabilization of polarity axis 1.3E-08 338 439

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8IWF6|DEN6A_HUMAN Protein DENND6A OS=Homo sapiens GN=DENND6A PE=1 SV=1 137 588 3.0E-62
sp|Q8BH65|DEN6A_MOUSE Protein DENND6A OS=Mus musculus GN=Dennd6a PE=1 SV=1 137 588 9.0E-62
sp|Q5F3L4|DEN6A_CHICK Protein DENND6A OS=Gallus gallus GN=DENND6A PE=2 SV=1 137 598 8.0E-60
sp|Q9D9V7|DEN6B_MOUSE Protein DENND6B OS=Mus musculus GN=Dennd6b PE=2 SV=3 137 587 2.0E-58
sp|Q8NEG7|DEN6B_HUMAN Protein DENND6B OS=Homo sapiens GN=DENND6B PE=2 SV=1 137 587 2.0E-58
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8IWF6|DEN6A_HUMAN Protein DENND6A OS=Homo sapiens GN=DENND6A PE=1 SV=1 137 588 3.0E-62
sp|Q8BH65|DEN6A_MOUSE Protein DENND6A OS=Mus musculus GN=Dennd6a PE=1 SV=1 137 588 9.0E-62
sp|Q5F3L4|DEN6A_CHICK Protein DENND6A OS=Gallus gallus GN=DENND6A PE=2 SV=1 137 598 8.0E-60
sp|Q9D9V7|DEN6B_MOUSE Protein DENND6B OS=Mus musculus GN=Dennd6b PE=2 SV=3 137 587 2.0E-58
sp|Q8NEG7|DEN6B_HUMAN Protein DENND6B OS=Homo sapiens GN=DENND6B PE=2 SV=1 137 587 2.0E-58
sp|Q54VA9|F116_DICDI Protein DENND6 homolog OS=Dictyostelium discoideum GN=DDB_G0280481 PE=3 SV=1 118 588 7.0E-50
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 68 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|639450
MASEPEQTLTEPLEADISDFLSPSVYLDPPGSQISLAVSSPSSLSLSENFNDSPPPQPRNPGLEGRQLNRVSSPS
SPSLMTKTSFSIAERLKQTRPGLPRSVSLPRVDQVEVKQRKKVVDVDNISLDPDVVKKLRRWIMGVAIVEFDLDH
GPVVDAIVPPLFFLPSESNNIAFSAFPDSPQFDQGSQCHSFCLREQLSSAYDTKRPATIDGYIYGFSHFTQKRDK
ASKRGYLQRSVVILTQHQYPAFFTSLVHIFGPLFLEHGSPMLEAACHNIATWSDPKPGETLELGFLGMVINVEIP
HTIDQFQLTETSSFNEKYDPKLHVLASSAPFFPPPLLLFESCLPNLWSIWECLVLCEPLLVFGQSAAQTSQAVWW
LRDLLRPVPLAGDIRPYFTLQDNDHATLVNRLPPKAGLILGVTNPFFEKSCSHWPHVLSLGSRKGGSPNVRPSAS
PLAGPNGNSAGPAPGWKTKTHRRYISKDHTLLKELESAIRGNDRQKLRASFALRRHFCSRTADLIAPLARYLNTL
IPSPHEVAEARSSKECLRLKPFSHTSFFVSLKKNGCTLPFKSTAKRVQFYERWLKSPSFGVWLAHQESIVQTILN
TPVNLTTTPTLS*
Coding >Agabi119p4|639450
ATGGCTTCGGAACCAGAACAAACTCTCACAGAACCGTTGGAGGCTGACATCTCCGACTTTCTGTCCCCTTCAGTC
TATCTCGATCCTCCGGGCTCGCAAATCAGTCTAGCTGTGTCAAGTCCAAGTTCACTGAGTTTGAGCGAGAATTTC
AACGACAGCCCACCTCCTCAACCGAGGAATCCTGGACTTGAAGGGCGACAGCTTAACAGAGTGTCATCACCTTCA
TCTCCGTCTCTAATGACCAAGACTTCGTTTTCGATCGCCGAACGGTTGAAACAGACTCGTCCAGGTCTTCCGAGG
TCGGTTTCTTTACCGAGAGTAGATCAGGTTGAGGTGAAGCAAAGAAAGAAGGTGGTGGATGTGGATAACATCTCT
CTTGATCCGGACGTGGTCAAGAAATTGAGGAGATGGATTATGGGTGTTGCAATAGTCGAATTCGACCTTGACCAT
GGGCCTGTGGTGGATGCTATCGTACCACCACTGTTCTTTTTACCTTCCGAGTCGAACAACATTGCTTTTTCAGCA
TTCCCTGATTCTCCGCAATTTGATCAAGGATCACAATGTCATTCTTTTTGTTTGCGCGAACAATTATCTTCAGCC
TATGATACTAAACGACCAGCTACGATTGACGGATATATTTATGGATTTTCTCATTTCACGCAGAAGCGAGACAAG
GCTTCGAAACGAGGTTACTTACAGCGCTCCGTTGTCATCCTTACTCAACACCAATACCCAGCGTTTTTTACTTCC
CTAGTACACATTTTTGGACCTCTGTTCCTCGAGCATGGATCACCGATGCTGGAAGCGGCATGTCATAACATCGCT
ACATGGTCCGATCCTAAACCGGGAGAAACTCTAGAACTAGGCTTCCTTGGGATGGTCATCAATGTGGAGATACCA
CACACGATTGATCAATTTCAATTGACAGAGACGTCTTCGTTCAATGAAAAGTATGACCCCAAACTACATGTTTTA
GCTTCCTCTGCGCCATTTTTCCCGCCCCCATTGCTTTTGTTTGAGTCGTGTTTGCCCAATCTATGGTCGATATGG
GAATGTCTTGTACTTTGTGAACCGTTGCTCGTTTTTGGACAGTCGGCTGCACAGACGAGTCAGGCGGTATGGTGG
TTAAGAGATTTATTACGGCCCGTTCCCCTTGCTGGCGACATACGCCCGTATTTTACGCTCCAGGATAATGACCAT
GCGACGTTGGTGAACAGGTTACCTCCGAAGGCAGGATTGATACTTGGAGTCACAAATCCTTTTTTTGAAAAGTCA
TGTTCTCATTGGCCACACGTCCTCAGTTTAGGGAGTCGAAAAGGAGGATCGCCTAATGTGCGGCCCTCGGCCTCA
CCTCTTGCGGGCCCTAACGGGAACTCAGCCGGACCAGCACCTGGATGGAAGACCAAAACCCACAGACGATATATA
TCCAAAGACCATACGTTGCTGAAAGAACTAGAATCAGCTATTCGAGGGAACGATCGGCAAAAGCTTCGCGCGTCG
TTCGCCCTTCGTCGTCATTTTTGCTCTCGCACTGCCGATCTAATTGCTCCACTTGCAAGATACCTTAATACCTTG
ATACCCTCACCTCACGAGGTGGCCGAAGCTCGATCCTCGAAGGAATGTCTTCGCCTTAAACCATTTAGTCACACG
AGTTTTTTCGTTTCACTCAAGAAGAATGGCTGCACTTTACCCTTCAAATCGACTGCCAAACGGGTGCAATTTTAT
GAAAGGTGGCTCAAATCGCCGAGTTTTGGAGTGTGGCTTGCCCATCAGGAGTCGATTGTCCAGACTATTCTAAAC
ACGCCTGTTAATCTTACTACTACGCCGACCTTGTCGTGA
Transcript >Agabi119p4|639450
ATGGCTTCGGAACCAGAACAAACTCTCACAGAACCGTTGGAGGCTGACATCTCCGACTTTCTGTCCCCTTCAGTC
TATCTCGATCCTCCGGGCTCGCAAATCAGTCTAGCTGTGTCAAGTCCAAGTTCACTGAGTTTGAGCGAGAATTTC
AACGACAGCCCACCTCCTCAACCGAGGAATCCTGGACTTGAAGGGCGACAGCTTAACAGAGTGTCATCACCTTCA
TCTCCGTCTCTAATGACCAAGACTTCGTTTTCGATCGCCGAACGGTTGAAACAGACTCGTCCAGGTCTTCCGAGG
TCGGTTTCTTTACCGAGAGTAGATCAGGTTGAGGTGAAGCAAAGAAAGAAGGTGGTGGATGTGGATAACATCTCT
CTTGATCCGGACGTGGTCAAGAAATTGAGGAGATGGATTATGGGTGTTGCAATAGTCGAATTCGACCTTGACCAT
GGGCCTGTGGTGGATGCTATCGTACCACCACTGTTCTTTTTACCTTCCGAGTCGAACAACATTGCTTTTTCAGCA
TTCCCTGATTCTCCGCAATTTGATCAAGGATCACAATGTCATTCTTTTTGTTTGCGCGAACAATTATCTTCAGCC
TATGATACTAAACGACCAGCTACGATTGACGGATATATTTATGGATTTTCTCATTTCACGCAGAAGCGAGACAAG
GCTTCGAAACGAGGTTACTTACAGCGCTCCGTTGTCATCCTTACTCAACACCAATACCCAGCGTTTTTTACTTCC
CTAGTACACATTTTTGGACCTCTGTTCCTCGAGCATGGATCACCGATGCTGGAAGCGGCATGTCATAACATCGCT
ACATGGTCCGATCCTAAACCGGGAGAAACTCTAGAACTAGGCTTCCTTGGGATGGTCATCAATGTGGAGATACCA
CACACGATTGATCAATTTCAATTGACAGAGACGTCTTCGTTCAATGAAAAGTATGACCCCAAACTACATGTTTTA
GCTTCCTCTGCGCCATTTTTCCCGCCCCCATTGCTTTTGTTTGAGTCGTGTTTGCCCAATCTATGGTCGATATGG
GAATGTCTTGTACTTTGTGAACCGTTGCTCGTTTTTGGACAGTCGGCTGCACAGACGAGTCAGGCGGTATGGTGG
TTAAGAGATTTATTACGGCCCGTTCCCCTTGCTGGCGACATACGCCCGTATTTTACGCTCCAGGATAATGACCAT
GCGACGTTGGTGAACAGGTTACCTCCGAAGGCAGGATTGATACTTGGAGTCACAAATCCTTTTTTTGAAAAGTCA
TGTTCTCATTGGCCACACGTCCTCAGTTTAGGGAGTCGAAAAGGAGGATCGCCTAATGTGCGGCCCTCGGCCTCA
CCTCTTGCGGGCCCTAACGGGAACTCAGCCGGACCAGCACCTGGATGGAAGACCAAAACCCACAGACGATATATA
TCCAAAGACCATACGTTGCTGAAAGAACTAGAATCAGCTATTCGAGGGAACGATCGGCAAAAGCTTCGCGCGTCG
TTCGCCCTTCGTCGTCATTTTTGCTCTCGCACTGCCGATCTAATTGCTCCACTTGCAAGATACCTTAATACCTTG
ATACCCTCACCTCACGAGGTGGCCGAAGCTCGATCCTCGAAGGAATGTCTTCGCCTTAAACCATTTAGTCACACG
AGTTTTTTCGTTTCACTCAAGAAGAATGGCTGCACTTTACCCTTCAAATCGACTGCCAAACGGGTGCAATTTTAT
GAAAGGTGGCTCAAATCGCCGAGTTTTGGAGTGTGGCTTGCCCATCAGGAGTCGATTGTCCAGACTATTCTAAAC
ACGCCTGTTAATCTTACTACTACGCCGACCTTGTCGTGA
Gene >Agabi119p4|639450
ATGGCTTCGGAACCAGAACAAACTCTCACAGAACCGTTGGAGGCTGACATCTCCGACTTTCTGTCCCCTTCAGTC
TATCTCGATCCTCCGGGCTCGCAAATCAGTCTAGCTGTGTCAAGTCCAAGTTCACTGAGTTTGAGCGAGAATTTC
AACGACAGCCCACCTCCTCAACCGAGGAATCCTGGACTTGAAGGGCGACAGCTTAACAGAGTGTCATCACCTTCA
TCTCCGTCTCTAATGACCAAGACTTCGTTTTCGATCGCCGAACGGTTGAAACAGACTCGTCCAGGTCTTCCGAGG
TCGGTTTCTTTACCGAGAGTAGATCAGGTTGAGGTGAAGCAAAGAAAGAAGGTGGTGGATGTGGATAACATCTCT
CTTGATCCGGACGTGGTCAAGAAATTGAGGAGATGGATTATGGGTGTTGCAATAGGCGAGCCTTCCTTGTTCCTC
TCTTGTCGACAAATCTGACCGCTCTCTAGTCGAATTCGACCTTGACCATGGGCCTGTGGTGGATGCTATCGTACC
ACCACTGTTCTTTTTACCTTCCGAGTCGAACAACATGTGCGCCAATCACCTTGGACGTTGAACCTCAAGCTGACC
TCTGTTCAGTGCTTTTTCAGCATTCCCTGATTCTCCGCAATTTGATCAAGGATCACAATGTCATTCTTTTTGTTT
GCGCGAACAATTATCTTCAGCCTATGATACTAAACGACCAGCTACGATTGACGGATATATTTATGGATTTTCTCA
TTTCACGCAGAAGCGAGACAAGGCTTCGAAACGAGGTTACTTACAGGTATCTATTTATTTCCTCTTCGTGGCTGT
CACGTCGTTGATTTCAATCAAGCGCTCCGTTGTCATCCTTACTCAACACCAATACCCAGCGTTTTTTACTTCCCT
AGTACACATTTTTGGACCTCTGTTCCTCGAGCATGGATCACCGATGCTGGAAGCGGCATGTCATAACATCGCTAC
ATGGTACGACTCTATTTCCGGGTTTTGTTGCGTCGGGCCAATGATGAGAAGAGCAGGTCCGATCCTAAACCGGGA
GAAACTCTAGAACTAGGCTTCCTTGGGATGGTCATCAATGTGGAGATACCACACACGATTGATCAATTTCAATTG
ACAGAGACGTCTTCGTTCAATGAAAAGTATGACCCCAAACTACATGTGGGTCATTTATAGTTTCAGTCATGCCTT
TGCTGATCAGAGTATCAGGTTTTAGCTTCCTCTGCGCCATTTTTCCCGCCCCCATTGCTTTTGTTTGAGTCGTGT
TTGCCCAATCTATGGTCGATATGGGAATGTCTTGTACTTTGTGAACCGTTGCTCGTTTTTGGACAGTCGGCTGCA
CAGACGAGTCAGGCGGTATGGTGGTTAAGAGATTTATTACGGCCCGTGAGTTGTGGTATCTTCTTTAGAACCATT
CACCCCATCTCAATCCTTCTTCCTTATTCAGGTTCCCCTTGCTGGCGACATACGCCCGTATTTTACGCTCCAGGA
TAATGACCATGCGACGTTGGTGAACAGGTTACCTCCGAAGGCAGGATTGATACTTGGAGTCACAAATCCTTTTTT
TGAAAAGTCATGTTCTCATTGGCCACACGTCCTCAGTTTAGGGAGTCGAAAAGGAGGGTATGTATAATAACGATT
GTGGATTTTTTGCGAAAAGTCATTGAGAACCACTTAGATCGCCTAATGTGCGGCCCTCGGCCTCACCTCTTGCGG
GCCCTAACGGGAACTCAGCCGGACCAGCACCTGGATGGAAGACCAAAACCCACAGACGATATATATCCAAAGACC
ATACGTTGCTGAAAGAACTAGAATCAGCTATTCGAGGGAACGATCGGCAAAGTAAGTGCATGGTTCTTTCGTTCA
AGTGCTTTGACAAACCACCGAATACAGAGCTTCGCGCGTCGTTCGCCCTTCGTCGTCATTTTTGCTCTCGCACTG
CCGATCTAATTGCTCCACTTGCAAGATACCTTAATACCTTGATACCCTCACCTCACGAGGTGGCCGAAGCTCGAT
CCTCGAAGGAATGTCTTCGCCTTAAACCATTTAGTCACACGAGTTTTTTCGTTTCACTCAAGAAGAATGGCTGCA
CTTTACCCTTCAAATCGACTGCCAAACGGGTGCAATTTTATGAAAGGTACGTCTTGTCGTTTGAAGTACAAGGCA
TGGCTGATGTTTCTAACACCGTAGGTGGCTCAAATCGCCGAGTTTTGGAGTGTGGCTTGCCCATCAGGAGTCGAT
TGTCCAGACTATTCTAAACACGCCTGTTAATCTTACTACTACGCCGACCTTGTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail