Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|639050
Gene name
Locationscaffold_05a:499424..500428
Strand+
Gene length (bp)1004
Transcript length (bp)822
Coding sequence length (bp)822
Protein length (aa) 274

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00652 Ricin_B_lectin Ricin-type beta-trefoil lectin domain 1.3E-23 131 253
PF14200 RicinB_lectin_2 Ricin-type beta-trefoil lectin domain-like 2.5E-09 132 198

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P26514|XYNA_STRLI Endo-1,4-beta-xylanase A OS=Streptomyces lividans GN=xlnA PE=1 SV=2 117 255 4.0E-11
sp|O54161|EABF_STRCO Extracellular exo-alpha-L-arabinofuranosidase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=abfB PE=1 SV=1 137 254 5.0E-09
sp|P96463|EABF_STRLI Extracellular exo-alpha-L-arabinofuranosidase OS=Streptomyces lividans GN=abfB PE=1 SV=2 137 254 2.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|639050
MMFSWNLVSLAVVLNAASAVISLPVASESASVPTSSTLAITTTVPSDVTSTVVLPTTSEVPTLVPPSTSVPSTVV
PTTTTGVPSTVVPTTTTGVPSTVVPTTTASIPSTITFPTTTGSPTPTPVPFVQINPNGNTAKCLDVQGAVLANGT
PVQIFDCNQTPAQQWVIAPGQGQVQLANTNFCLDAGASPASGTGMKIWECFDNLPAQDWFYTDDKRVALTNQGFC
LDLTNGDLTNGSQAQVWKCTDNNTNQIWTTSTVAVPLPDPPMSTLVAA*
Coding >Agabi119p4|639050
ATGATGTTCTCTTGGAACTTGGTCTCCCTGGCAGTCGTGCTCAATGCAGCCAGCGCAGTGATCTCCCTCCCTGTC
GCATCCGAATCTGCCTCCGTTCCAACTAGCTCTACGCTCGCTATCACTACCACTGTCCCTTCTGATGTTACTTCG
ACCGTTGTTCTCCCTACCACCAGCGAAGTTCCTACTCTTGTCCCCCCTTCCACTAGTGTTCCTTCTACCGTTGTC
CCCACTACTACCACCGGTGTTCCCTCTACCGTTGTCCCTACTACTACCACCGGTGTTCCTTCTACCGTTGTCCCT
ACTACTACTGCCAGTATCCCGTCTACCATCACTTTCCCTACCACTACGGGTTCTCCCACCCCTACTCCTGTACCC
TTTGTGCAGATCAACCCTAACGGAAACACTGCCAAGTGCTTGGACGTCCAAGGTGCAGTTCTCGCGAACGGAACC
CCTGTCCAAATTTTTGATTGTAATCAAACTCCTGCTCAACAATGGGTCATTGCACCTGGCCAAGGTCAAGTCCAA
TTGGCGAATACTAATTTCTGTTTGGACGCCGGTGCTTCGCCAGCTTCCGGTACTGGAATGAAGATCTGGGAATGC
TTCGATAACTTACCAGCTCAGGATTGGTTCTACACTGATGACAAGAGGGTCGCTCTCACCAACCAAGGCTTCTGT
CTCGATCTCACCAATGGAGACTTGACCAACGGAAGCCAAGCACAGGTTTGGAAGTGCACGGACAACAATACCAAC
CAGATCTGGACCACCTCTACGGTCGCAGTTCCTCTCCCGGACCCGCCGATGTCCACACTGGTAGCTGCATGA
Transcript >Agabi119p4|639050
ATGATGTTCTCTTGGAACTTGGTCTCCCTGGCAGTCGTGCTCAATGCAGCCAGCGCAGTGATCTCCCTCCCTGTC
GCATCCGAATCTGCCTCCGTTCCAACTAGCTCTACGCTCGCTATCACTACCACTGTCCCTTCTGATGTTACTTCG
ACCGTTGTTCTCCCTACCACCAGCGAAGTTCCTACTCTTGTCCCCCCTTCCACTAGTGTTCCTTCTACCGTTGTC
CCCACTACTACCACCGGTGTTCCCTCTACCGTTGTCCCTACTACTACCACCGGTGTTCCTTCTACCGTTGTCCCT
ACTACTACTGCCAGTATCCCGTCTACCATCACTTTCCCTACCACTACGGGTTCTCCCACCCCTACTCCTGTACCC
TTTGTGCAGATCAACCCTAACGGAAACACTGCCAAGTGCTTGGACGTCCAAGGTGCAGTTCTCGCGAACGGAACC
CCTGTCCAAATTTTTGATTGTAATCAAACTCCTGCTCAACAATGGGTCATTGCACCTGGCCAAGGTCAAGTCCAA
TTGGCGAATACTAATTTCTGTTTGGACGCCGGTGCTTCGCCAGCTTCCGGTACTGGAATGAAGATCTGGGAATGC
TTCGATAACTTACCAGCTCAGGATTGGTTCTACACTGATGACAAGAGGGTCGCTCTCACCAACCAAGGCTTCTGT
CTCGATCTCACCAATGGAGACTTGACCAACGGAAGCCAAGCACAGGTTTGGAAGTGCACGGACAACAATACCAAC
CAGATCTGGACCACCTCTACGGTCGCAGTTCCTCTCCCGGACCCGCCGATGTCCACACTGGTAGCTGCATGA
Gene >Agabi119p4|639050
ATGATGTTCTCTTGGAACTTGGTCTCCCTGGCAGTCGTGCTCAATGCAGCCAGCGCAGTGATCTCCCTCCCTGTC
GCATCCGAATCTGCCTCCGTTCCAACTAGCTCTACGCTCGCTATCACTACCACTGTCCCTTCTGATGTTACTTCG
ACCGTTGTTCTCCCTACCACCAGCGAAGTTCCTACTCTTGTCCCCCCTTCCACTAGTGTTCCTTCTACCGTTGTC
CCCACTACTACCACCGGTGTTCCCTCTACCGTTGTCCCTACTACTACCACCGGTGTTCCTTCTACCGTTGTCCCT
ACTACTACTGCCAGTATCCCGTCTACCATCACTTTCCCTACCACTACGGGTTCTCCCACCCCTACTCCTGTACCC
TTTGTGCAGATCAACCCTAACGGAAACACTGCCAAGTGCTTGGACGTCCAAGGTGCAGTTCTCGCGAACGGAACC
CCTGTCCAAATGTTTGTTGTTTTCTTCAAATTCTCACACCCGTGGCAGCAAATGCTCACGTTTTCGTAACAGTTT
TGATTGTAATCAAACTCCTGCTCAACAATGGGTCATTGCACCTGGCCAAGGTCAAGTCCAATTGGCGAATACTAA
TTTCTGTTTGGACGCCGGTGCTTGTAAGTATACCAAACATAAAGTGTCAATTCTACGGTGCTAATCAAATTTCTA
AAAATAAAACAATAGCGCCAGCTTCCGGTACTGGAATGAAGATCTGGGAATGCTTCGATAACTTACCAGCTCAGG
ATTGGTTCTACACTGATGACAAGAGGGTCGCTCTCACCAACCAAGGTAAAGGTGGGATATACTATATGTAGAAAA
CCGCAACTAATGATTTCTTTAAAGGCTTCTGTCTCGATCTCACCAATGGAGACTTGACCAACGGAAGCCAAGCAC
AGGTTTGGAAGTGCACGGACAACAATACCAACCAGATCTGGACCACCTCTACGGTCGCAGTTCCTCTCCCGGACC
CGCCGATGTCCACACTGGTAGCTGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail