Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|637100
Gene name
Locationscaffold_05a:406150..407686
Strand-
Gene length (bp)1536
Transcript length (bp)1536
Coding sequence length (bp)1536
Protein length (aa) 512

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14223 Retrotran_gag_2 gag-polypeptide of LTR copia-type 6.8E-13 36 162

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID5
Orthogroup218
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|082250
Agaricus bisporus var bisporus H97 AgabiH97|082250
Agaricus bisporus var burnettii H119p4 Agabi119p4|564700
Agaricus bisporus var burnettii H119p4 Agabi119p4|606100
Agaricus bisporus var burnettii H119p4 Agabi119p4|637100 (this protein)
Agaricus bisporus var burnettii H119p4 Agabi119p4|770150
Agaricus bisporus var burnettii H119p4 Agabi119p4|770800

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|637100
MVNGSDNSAWEMSGSPAPPLPTTDPVELRARALLSARASAIIESHLPNSMLSQAAAQTDARALWSWLEGQYGQKG
PTFAYERFVTAQNFKINDSADPSSAIADLYALFAAVESTGALIHESIRTMMLLNALPNRFEHVASNILAEKRSVA
DLKWEETRARIIAAWRNPHTVANAACFRQQNQPKPKWDNKKPDQGQGKSQGSGSGSGSSQNQNKQQQPQQKGEQQ
SEGNKKKRTRSRKKKQGNEASTASIKEVKDTTPDYSASSAIASMTRLASNSTRAKVDEMKSRFVPLPSRSDPNLT
RNRSPKLGNHTISGEEFLFFPDGNMIDLSPPDTDIDSWTLPRLRPAMRNLLSDESDVDLDPSDSGSIPRDPRKRP
SSRHSPTPYERAKTKVLSLWDQRLNAVTVTAPPIEDGAGQVGGNAPAVKMPATKGNKLRRWMSIRLMRFLSAMKM
ENLSMNTMRSANRIALRKSLAPLPYLRLTHGFYRAVLSPETKAWLNQPISEEDRAALRGFD*
Coding >Agabi119p4|637100
ATGGTCAACGGCTCGGATAATTCGGCTTGGGAGATGAGTGGTTCCCCCGCTCCTCCTCTGCCAACCACAGACCCG
GTCGAGTTACGAGCTCGTGCTCTGCTCTCAGCCCGAGCGTCTGCAATAATCGAGTCCCATCTCCCAAATTCGATG
CTCAGCCAGGCGGCCGCCCAAACGGACGCCAGAGCTCTTTGGAGTTGGTTAGAAGGCCAGTACGGCCAAAAAGGA
CCGACATTCGCTTACGAGCGATTTGTCACGGCTCAGAATTTCAAGATTAATGACTCCGCGGATCCATCGTCTGCG
ATTGCAGATCTCTACGCCCTATTCGCTGCTGTTGAAAGCACCGGTGCGTTGATCCACGAGTCGATCCGCACCATG
ATGCTCCTCAACGCTCTCCCCAACCGGTTCGAGCATGTCGCTTCGAACATTCTTGCTGAGAAAAGATCGGTCGCC
GATCTTAAATGGGAGGAAACCCGTGCCCGCATCATCGCCGCGTGGCGCAACCCCCATACAGTTGCCAATGCTGCG
TGTTTCCGCCAGCAAAACCAGCCTAAACCTAAATGGGACAACAAGAAACCCGATCAAGGTCAGGGTAAGTCCCAA
GGCTCTGGTTCTGGTTCTGGCTCCAGCCAGAACCAAAATAAGCAACAACAACCTCAGCAGAAAGGTGAGCAGCAG
AGTGAAGGCAACAAGAAGAAGAGAACCCGCTCCCGTAAAAAGAAGCAGGGTAATGAGGCTTCTACAGCCTCTATC
AAAGAAGTCAAGGACACCACTCCTGACTACTCCGCTTCTTCTGCCATCGCTTCGATGACGCGGCTCGCATCCAAC
TCTACTCGTGCGAAAGTTGATGAGATGAAGAGCAGGTTTGTCCCGCTACCATCTAGATCAGATCCAAATCTAACG
AGGAATAGATCGCCCAAGTTGGGCAACCATACTATTTCGGGTGAGGAATTTCTCTTCTTCCCTGATGGTAATATG
ATTGATCTTTCCCCTCCGGATACTGACATTGACTCTTGGACTTTGCCTCGGCTTCGTCCCGCAATGCGAAATCTC
CTTTCGGACGAATCTGATGTTGATCTTGATCCATCAGACTCCGGGTCGATCCCTCGGGACCCTCGGAAACGTCCT
TCCTCTCGCCATTCCCCCACGCCCTACGAAAGGGCCAAGACGAAAGTGTTATCCCTTTGGGATCAACGTCTTAAC
GCAGTGACTGTAACAGCCCCTCCAATCGAGGATGGGGCCGGTCAAGTGGGTGGTAATGCTCCGGCTGTAAAAATG
CCGGCTACGAAAGGAAACAAGTTGAGAAGATGGATGTCGATAAGGCTGATGAGATTTCTCTCGGCGATGAAGATG
GAGAATTTGAGTATGAATACGATGCGGAGTGCGAACCGGATAGCTTTGCGCAAGTCCCTCGCTCCTCTTCCATAT
CTCAGATTAACTCATGGATTCTACAGGGCAGTTCTATCTCCAGAAACAAAGGCTTGGTTGAACCAGCCTATCTCC
GAGGAAGATCGGGCCGCTCTTCGTGGCTTCGATTAG
Transcript >Agabi119p4|637100
ATGGTCAACGGCTCGGATAATTCGGCTTGGGAGATGAGTGGTTCCCCCGCTCCTCCTCTGCCAACCACAGACCCG
GTCGAGTTACGAGCTCGTGCTCTGCTCTCAGCCCGAGCGTCTGCAATAATCGAGTCCCATCTCCCAAATTCGATG
CTCAGCCAGGCGGCCGCCCAAACGGACGCCAGAGCTCTTTGGAGTTGGTTAGAAGGCCAGTACGGCCAAAAAGGA
CCGACATTCGCTTACGAGCGATTTGTCACGGCTCAGAATTTCAAGATTAATGACTCCGCGGATCCATCGTCTGCG
ATTGCAGATCTCTACGCCCTATTCGCTGCTGTTGAAAGCACCGGTGCGTTGATCCACGAGTCGATCCGCACCATG
ATGCTCCTCAACGCTCTCCCCAACCGGTTCGAGCATGTCGCTTCGAACATTCTTGCTGAGAAAAGATCGGTCGCC
GATCTTAAATGGGAGGAAACCCGTGCCCGCATCATCGCCGCGTGGCGCAACCCCCATACAGTTGCCAATGCTGCG
TGTTTCCGCCAGCAAAACCAGCCTAAACCTAAATGGGACAACAAGAAACCCGATCAAGGTCAGGGTAAGTCCCAA
GGCTCTGGTTCTGGTTCTGGCTCCAGCCAGAACCAAAATAAGCAACAACAACCTCAGCAGAAAGGTGAGCAGCAG
AGTGAAGGCAACAAGAAGAAGAGAACCCGCTCCCGTAAAAAGAAGCAGGGTAATGAGGCTTCTACAGCCTCTATC
AAAGAAGTCAAGGACACCACTCCTGACTACTCCGCTTCTTCTGCCATCGCTTCGATGACGCGGCTCGCATCCAAC
TCTACTCGTGCGAAAGTTGATGAGATGAAGAGCAGGTTTGTCCCGCTACCATCTAGATCAGATCCAAATCTAACG
AGGAATAGATCGCCCAAGTTGGGCAACCATACTATTTCGGGTGAGGAATTTCTCTTCTTCCCTGATGGTAATATG
ATTGATCTTTCCCCTCCGGATACTGACATTGACTCTTGGACTTTGCCTCGGCTTCGTCCCGCAATGCGAAATCTC
CTTTCGGACGAATCTGATGTTGATCTTGATCCATCAGACTCCGGGTCGATCCCTCGGGACCCTCGGAAACGTCCT
TCCTCTCGCCATTCCCCCACGCCCTACGAAAGGGCCAAGACGAAAGTGTTATCCCTTTGGGATCAACGTCTTAAC
GCAGTGACTGTAACAGCCCCTCCAATCGAGGATGGGGCCGGTCAAGTGGGTGGTAATGCTCCGGCTGTAAAAATG
CCGGCTACGAAAGGAAACAAGTTGAGAAGATGGATGTCGATAAGGCTGATGAGATTTCTCTCGGCGATGAAGATG
GAGAATTTGAGTATGAATACGATGCGGAGTGCGAACCGGATAGCTTTGCGCAAGTCCCTCGCTCCTCTTCCATAT
CTCAGATTAACTCATGGATTCTACAGGGCAGTTCTATCTCCAGAAACAAAGGCTTGGTTGAACCAGCCTATCTCC
GAGGAAGATCGGGCCGCTCTTCGTGGCTTCGATTAG
Gene >Agabi119p4|637100
ATGGTCAACGGCTCGGATAATTCGGCTTGGGAGATGAGTGGTTCCCCCGCTCCTCCTCTGCCAACCACAGACCCG
GTCGAGTTACGAGCTCGTGCTCTGCTCTCAGCCCGAGCGTCTGCAATAATCGAGTCCCATCTCCCAAATTCGATG
CTCAGCCAGGCGGCCGCCCAAACGGACGCCAGAGCTCTTTGGAGTTGGTTAGAAGGCCAGTACGGCCAAAAAGGA
CCGACATTCGCTTACGAGCGATTTGTCACGGCTCAGAATTTCAAGATTAATGACTCCGCGGATCCATCGTCTGCG
ATTGCAGATCTCTACGCCCTATTCGCTGCTGTTGAAAGCACCGGTGCGTTGATCCACGAGTCGATCCGCACCATG
ATGCTCCTCAACGCTCTCCCCAACCGGTTCGAGCATGTCGCTTCGAACATTCTTGCTGAGAAAAGATCGGTCGCC
GATCTTAAATGGGAGGAAACCCGTGCCCGCATCATCGCCGCGTGGCGCAACCCCCATACAGTTGCCAATGCTGCG
TGTTTCCGCCAGCAAAACCAGCCTAAACCTAAATGGGACAACAAGAAACCCGATCAAGGTCAGGGTAAGTCCCAA
GGCTCTGGTTCTGGTTCTGGCTCCAGCCAGAACCAAAATAAGCAACAACAACCTCAGCAGAAAGGTGAGCAGCAG
AGTGAAGGCAACAAGAAGAAGAGAACCCGCTCCCGTAAAAAGAAGCAGGGTAATGAGGCTTCTACAGCCTCTATC
AAAGAAGTCAAGGACACCACTCCTGACTACTCCGCTTCTTCTGCCATCGCTTCGATGACGCGGCTCGCATCCAAC
TCTACTCGTGCGAAAGTTGATGAGATGAAGAGCAGGTTTGTCCCGCTACCATCTAGATCAGATCCAAATCTAACG
AGGAATAGATCGCCCAAGTTGGGCAACCATACTATTTCGGGTGAGGAATTTCTCTTCTTCCCTGATGGTAATATG
ATTGATCTTTCCCCTCCGGATACTGACATTGACTCTTGGACTTTGCCTCGGCTTCGTCCCGCAATGCGAAATCTC
CTTTCGGACGAATCTGATGTTGATCTTGATCCATCAGACTCCGGGTCGATCCCTCGGGACCCTCGGAAACGTCCT
TCCTCTCGCCATTCCCCCACGCCCTACGAAAGGGCCAAGACGAAAGTGTTATCCCTTTGGGATCAACGTCTTAAC
GCAGTGACTGTAACAGCCCCTCCAATCGAGGATGGGGCCGGTCAAGTGGGTGGTAATGCTCCGGCTGTAAAAATG
CCGGCTACGAAAGGAAACAAGTTGAGAAGATGGATGTCGATAAGGCTGATGAGATTTCTCTCGGCGATGAAGATG
GAGAATTTGAGTATGAATACGATGCGGAGTGCGAACCGGATAGCTTTGCGCAAGTCCCTCGCTCCTCTTCCATAT
CTCAGATTAACTCATGGATTCTACAGGGCAGTTCTATCTCCAGAAACAAAGGCTTGGTTGAACCAGCCTATCTCC
GAGGAAGATCGGGCCGCTCTTCGTGGCTTCGATTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail