Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|636550
Gene name
Locationscaffold_05a:340680..341281
Strand+
Gene length (bp)601
Transcript length (bp)438
Coding sequence length (bp)438
Protein length (aa) 146

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00135 COesterase Carboxylesterase family 2.1E-31 25 143

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P14943|EST2_RABIT Liver carboxylesterase 2 OS=Oryctolagus cuniculus GN=CES2 PE=1 SV=2 16 144 1.0E-20
sp|P06276|CHLE_HUMAN Cholinesterase OS=Homo sapiens GN=BCHE PE=1 SV=1 3 138 2.0E-18
sp|Q86GC9|ACES_CULTO Acetylcholinesterase (Fragment) OS=Culex torrentium GN=ACE-1 PE=3 SV=1 40 138 4.0E-18
sp|Q867X2|ACES_CULQU Acetylcholinesterase (Fragment) OS=Culex quinquefasciatus GN=ACE-1 PE=3 SV=1 40 138 4.0E-18
sp|Q867X3|ACES_CULPP Acetylcholinesterase (Fragment) OS=Culex pipiens pipiens GN=ACE-1 PE=3 SV=1 40 138 4.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P14943|EST2_RABIT Liver carboxylesterase 2 OS=Oryctolagus cuniculus GN=CES2 PE=1 SV=2 16 144 1.0E-20
sp|P06276|CHLE_HUMAN Cholinesterase OS=Homo sapiens GN=BCHE PE=1 SV=1 3 138 2.0E-18
sp|Q86GC9|ACES_CULTO Acetylcholinesterase (Fragment) OS=Culex torrentium GN=ACE-1 PE=3 SV=1 40 138 4.0E-18
sp|Q867X2|ACES_CULQU Acetylcholinesterase (Fragment) OS=Culex quinquefasciatus GN=ACE-1 PE=3 SV=1 40 138 4.0E-18
sp|Q867X3|ACES_CULPP Acetylcholinesterase (Fragment) OS=Culex pipiens pipiens GN=ACE-1 PE=3 SV=1 40 138 4.0E-18
sp|Q92035|ACES_BUNFA Acetylcholinesterase OS=Bungarus fasciatus GN=ACHE PE=1 SV=2 6 138 4.0E-18
sp|Q03311|CHLE_MOUSE Cholinesterase OS=Mus musculus GN=Bche PE=1 SV=2 27 138 5.0E-18
sp|Q869C3|ACES_ANOGA Acetylcholinesterase OS=Anopheles gambiae GN=Ace PE=3 SV=3 22 138 5.0E-18
sp|Q86GC8|ACES_CULPI Acetylcholinesterase OS=Culex pipiens GN=ACHE1 PE=2 SV=2 16 138 9.0E-18
sp|P37967|PNBA_BACSU Para-nitrobenzyl esterase OS=Bacillus subtilis (strain 168) GN=pnbA PE=1 SV=2 42 139 2.0E-17
sp|Q5UR02|CHLE_MIMIV Probable cholinesterase OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L906 PE=3 SV=1 4 136 4.0E-17
sp|P21927|CHLE_RABIT Cholinesterase OS=Oryctolagus cuniculus GN=BCHE PE=2 SV=1 27 138 5.0E-17
sp|P81908|CHLE_HORSE Cholinesterase OS=Equus caballus GN=BCHE PE=1 SV=1 27 138 7.0E-17
sp|Q8BK48|EST2E_MOUSE Pyrethroid hydrolase Ces2e OS=Mus musculus GN=Ces2e PE=1 SV=1 16 143 8.0E-17
sp|P32749|CHLE_BOVIN Cholinesterase OS=Bos taurus GN=BCHE PE=2 SV=2 27 138 1.0E-16
sp|Q04791|SASB_ANAPL Fatty acyl-CoA hydrolase precursor, medium chain OS=Anas platyrhynchos PE=1 SV=1 12 144 1.0E-16
sp|Q6AW47|EST5A_CANLF Carboxylesterase 5A OS=Canis lupus familiaris GN=CES5A PE=2 SV=1 44 144 2.0E-16
sp|Q64419|EST1_MESAU Liver carboxylesterase OS=Mesocricetus auratus PE=2 SV=1 31 143 6.0E-16
sp|O62760|CHLE_FELCA Cholinesterase OS=Felis catus GN=BCHE PE=2 SV=1 27 138 7.0E-16
sp|Q91WG0|EST2C_MOUSE Acylcarnitine hydrolase OS=Mus musculus GN=Ces2c PE=1 SV=1 14 143 2.0E-15
sp|P36196|ACES_CHICK Acetylcholinesterase OS=Gallus gallus GN=ACHE PE=2 SV=1 13 138 2.0E-15
sp|O62761|CHLE_PANTT Cholinesterase OS=Panthera tigris tigris GN=BCHE PE=2 SV=1 27 138 2.0E-15
sp|Q27677|ACES_LEPDE Acetylcholinesterase OS=Leptinotarsa decemlineata PE=2 SV=1 25 138 2.0E-15
sp|O00748|EST2_HUMAN Cocaine esterase OS=Homo sapiens GN=CES2 PE=1 SV=1 40 143 3.0E-15
sp|Q63880|EST3A_MOUSE Carboxylesterase 3A OS=Mus musculus GN=Ces3a PE=1 SV=2 26 144 4.0E-15
sp|O46421|EST1_MACFA Liver carboxylesterase 1 OS=Macaca fascicularis GN=CES1 PE=2 SV=1 1 141 4.0E-15
sp|Q8VCU1|EST3B_MOUSE Carboxylesterase 3B OS=Mus musculus GN=Ces3b PE=1 SV=2 26 144 4.0E-15
sp|Q8QZR3|EST2A_MOUSE Pyrethroid hydrolase Ces2a OS=Mus musculus GN=Ces2a PE=1 SV=1 1 143 5.0E-15
sp|Q27459|ACE1_CAEBR Acetylcholinesterase 1 OS=Caenorhabditis briggsae GN=ace-1 PE=3 SV=1 37 138 6.0E-15
sp|P23141|EST1_HUMAN Liver carboxylesterase 1 OS=Homo sapiens GN=CES1 PE=1 SV=2 32 141 8.0E-15
sp|P17573|LIP1_GEOCN Lipase 1 OS=Geotrichum candidum GN=LIP1 PE=1 SV=2 44 138 9.0E-15
sp|Q8I034|EST5A_FELCA Carboxylesterase 5A OS=Felis catus GN=CES5A PE=1 SV=1 44 144 1.0E-14
sp|Q9UKY3|CES1P_HUMAN Putative inactive carboxylesterase 4 OS=Homo sapiens GN=CES1P1 PE=5 SV=2 44 141 1.0E-14
sp|Q64176|EST1E_MOUSE Carboxylesterase 1E OS=Mus musculus GN=Ces1e PE=1 SV=1 47 141 1.0E-14
sp|P21836|ACES_MOUSE Acetylcholinesterase OS=Mus musculus GN=Ache PE=1 SV=1 24 138 2.0E-14
sp|W4VSJ0|ACES_TRILK Acetylcholinesterase-1 OS=Trittame loki PE=1 SV=1 27 138 2.0E-14
sp|Q64573|EST4_RAT Liver carboxylesterase 4 OS=Rattus norvegicus PE=2 SV=2 8 141 2.0E-14
sp|D4B1N9|LIP3_ARTBC Probable secreted lipase ARB_02369 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02369 PE=1 SV=1 30 141 4.0E-14
sp|Q5GRG2|EST5A_RAT Carboxylesterase 5A OS=Rattus norvegicus GN=Ces5a PE=1 SV=1 2 144 5.0E-14
sp|Q6NT32|EST5A_HUMAN Carboxylesterase 5A OS=Homo sapiens GN=CES5A PE=2 SV=1 44 144 6.0E-14
sp|Q6UWW8|EST3_HUMAN Carboxylesterase 3 OS=Homo sapiens GN=CES3 PE=1 SV=1 26 144 6.0E-14
sp|P20261|LIP1_CANRU Lipase 1 OS=Candida rugosa GN=LIP1 PE=1 SV=3 45 138 7.0E-14
sp|Q63010|EST5_RAT Liver carboxylesterase B-1 OS=Rattus norvegicus PE=1 SV=1 8 141 7.0E-14
sp|P37136|ACES_RAT Acetylcholinesterase OS=Rattus norvegicus GN=Ache PE=2 SV=1 24 138 8.0E-14
sp|P04058|ACES_TORCA Acetylcholinesterase OS=Torpedo californica GN=ache PE=1 SV=2 22 138 9.0E-14
sp|Q63108|EST1E_RAT Carboxylesterase 1E OS=Rattus norvegicus GN=Ces1e PE=2 SV=1 1 141 9.0E-14
sp|O62763|ACES_FELCA Acetylcholinesterase OS=Felis catus GN=ACHE PE=3 SV=1 24 138 1.0E-13
sp|Q5RCL7|EST3_PONAB Carboxylesterase 3 OS=Pongo abelii GN=CES3 PE=2 SV=2 26 144 1.0E-13
sp|P07692|ACES_TORMA Acetylcholinesterase OS=Torpedo marmorata GN=ache PE=1 SV=2 39 138 1.0E-13
sp|P22303|ACES_HUMAN Acetylcholinesterase OS=Homo sapiens GN=ACHE PE=1 SV=1 22 138 1.0E-13
sp|Q6AW46|EST5A_MOUSE Carboxylesterase 5A OS=Mus musculus GN=Ces5a PE=2 SV=1 2 144 1.0E-13
sp|P79066|LIP1_GEOFE Lipase 1 OS=Geotrichum fermentans GN=LIP1 PE=1 SV=1 44 138 2.0E-13
sp|P38433|ACE1_CAEEL Acetylcholinesterase 1 OS=Caenorhabditis elegans GN=ace-1 PE=1 SV=1 37 138 2.0E-13
sp|P22394|LIP2_GEOCN Lipase 2 OS=Geotrichum candidum GN=LIP2 PE=1 SV=2 44 138 2.0E-13
sp|P23795|ACES_BOVIN Acetylcholinesterase OS=Bos taurus GN=ACHE PE=1 SV=2 44 138 4.0E-13
sp|P32948|LIP4_CANRU Lipase 4 OS=Candida rugosa GN=LIP4 PE=3 SV=1 45 138 4.0E-13
sp|Q8VCT4|CES1D_MOUSE Carboxylesterase 1D OS=Mus musculus GN=Ces1d PE=1 SV=1 8 141 5.0E-13
sp|P32947|LIP3_CANRU Lipase 3 OS=Candida rugosa GN=LIP3 PE=1 SV=1 45 136 8.0E-13
sp|P23953|EST1C_MOUSE Carboxylesterase 1C OS=Mus musculus GN=Ces1c PE=1 SV=4 32 138 1.0E-12
sp|P16303|CES1D_RAT Carboxylesterase 1D OS=Rattus norvegicus GN=Ces1d PE=1 SV=2 9 141 1.0E-12
sp|P32949|LIP5_CANRU Lipase 5 OS=Candida rugosa GN=LIP5 PE=3 SV=1 45 136 1.0E-12
sp|P32946|LIP2_CANRU Lipase 2 OS=Candida rugosa GN=LIP2 PE=1 SV=1 45 138 1.0E-12
sp|Q07085|EST2_CAEEL Esterase CM06B1 OS=Caenorhabditis elegans GN=F13H6.3 PE=3 SV=3 44 138 2.0E-12
sp|P47982|EST6_DROMA Esterase 6 OS=Drosophila mauritiana GN=Est-6 PE=3 SV=1 16 139 4.0E-12
sp|Q29499|ACES_RABIT Acetylcholinesterase (Fragment) OS=Oryctolagus cuniculus GN=ACHE PE=2 SV=1 41 138 4.0E-12
sp|Q04456|EST1_CAEBR Gut esterase 1 OS=Caenorhabditis briggsae GN=ges-1 PE=2 SV=1 32 139 5.0E-12
sp|Q04457|EST1_CAEEL Gut esterase 1 OS=Caenorhabditis elegans GN=ges-1 PE=1 SV=1 43 139 7.0E-12
sp|P12337|EST1_RABIT Liver carboxylesterase 1 OS=Oryctolagus cuniculus PE=1 SV=3 32 141 8.0E-12
sp|Q5XG92|EST4A_HUMAN Carboxylesterase 4A OS=Homo sapiens GN=CES4A PE=2 SV=2 32 143 8.0E-12
sp|Q08662|EST6_DROSI Esterase 6 OS=Drosophila simulans GN=Est-6 PE=3 SV=1 16 139 1.0E-11
sp|Q29550|EST1_PIG Liver carboxylesterase OS=Sus scrofa PE=1 SV=1 10 141 1.0E-11
sp|O16172|EST5B_DROPE Esterase-5B OS=Drosophila persimilis GN=Est-5B PE=3 SV=1 16 140 1.0E-11
sp|Q8N0W4|NLGNX_HUMAN Neuroligin-4, X-linked OS=Homo sapiens GN=NLGN4X PE=1 SV=1 44 143 2.0E-11
sp|P08171|EST6_DROME Esterase-6 OS=Drosophila melanogaster GN=Est-6 PE=1 SV=2 2 139 2.0E-11
sp|Q8NFZ3|NLGNY_HUMAN Neuroligin-4, Y-linked OS=Homo sapiens GN=NLGN4Y PE=2 SV=1 44 143 5.0E-11
sp|Q01470|PCD_ARTOX Phenmedipham hydrolase OS=Arthrobacter oxydans GN=pcd PE=1 SV=1 42 138 5.0E-11
sp|P35501|ESTE_MYZPE Esterase E4 OS=Myzus persicae PE=1 SV=1 1 135 9.0E-11
sp|P35502|ESTF_MYZPE Esterase FE4 OS=Myzus persicae PE=1 SV=1 1 135 9.0E-11
sp|Q8VCC2|EST1_MOUSE Liver carboxylesterase 1 OS=Mus musculus GN=Ces1 PE=1 SV=1 3 141 1.0E-10
sp|P25726|EST5B_DROPS Esterase-5B OS=Drosophila pseudoobscura pseudoobscura GN=Est-5B PE=2 SV=2 16 140 1.0E-10
sp|D2D3B6|FUMD_SPHMC Fumonisin B1 esterase OS=Sphingopyxis macrogoltabida GN=fumD PE=1 SV=1 8 128 1.0E-10
sp|Q8BYM5|NLGN3_MOUSE Neuroligin-3 OS=Mus musculus GN=Nlgn3 PE=1 SV=2 9 143 1.0E-10
sp|P0C6R3|EST4A_BOVIN Carboxylesterase 4A OS=Bos taurus GN=CES4A PE=2 SV=1 32 143 1.0E-10
sp|O42275|ACES_ELEEL Acetylcholinesterase OS=Electrophorus electricus GN=ache PE=3 SV=1 2 127 2.0E-10
sp|P07140|ACES_DROME Acetylcholinesterase OS=Drosophila melanogaster GN=Ace PE=1 SV=1 25 138 3.0E-10
sp|O16170|EST5B_DROMI Esterase-5B OS=Drosophila miranda GN=Est-5B PE=3 SV=1 16 140 3.0E-10
sp|B2D0J5|EST6_APIME Venom carboxylesterase-6 OS=Apis mellifera PE=2 SV=1 31 143 5.0E-10
sp|Q9NDG8|ACE4_CAEBR Acetylcholinesterase 4 OS=Caenorhabditis briggsae GN=ace-4 PE=2 SV=1 3 138 1.0E-09
sp|Q47M62|EST1_THEFY Carboxylesterase OS=Thermobifida fusca (strain YX) GN=Tfu_2427 PE=3 SV=1 25 139 2.0E-09
sp|P86325|EST1_THEFU Carboxylesterase OS=Thermobifida fusca PE=1 SV=1 25 139 2.0E-09
sp|Q99K10|NLGN1_MOUSE Neuroligin-1 OS=Mus musculus GN=Nlgn1 PE=1 SV=2 44 143 2.0E-09
sp|Q9DDE3|ACES_DANRE Acetylcholinesterase OS=Danio rerio GN=ache PE=3 SV=1 42 127 2.0E-09
sp|O16171|EST5C_DROPE Esterase-5C OS=Drosophila persimilis GN=Est-5C PE=3 SV=1 1 140 3.0E-09
sp|O16169|EST5C_DROMI Esterase-5C OS=Drosophila miranda GN=Est-5C PE=3 SV=1 1 140 3.0E-09
sp|P25725|EST5C_DROPS Esterase-5C OS=Drosophila pseudoobscura pseudoobscura GN=Est-5C PE=3 SV=1 1 140 4.0E-09
sp|P01267|THYG_BOVIN Thyroglobulin OS=Bos taurus GN=TG PE=1 SV=1 44 139 4.0E-09
sp|Q62889|NLGN3_RAT Neuroligin-3 OS=Rattus norvegicus GN=Nlgn3 PE=1 SV=1 3 115 4.0E-09
sp|O94493|YC7C_SCHPO Uncharacterized esterase/lipase C417.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.12 PE=3 SV=2 46 142 6.0E-09
sp|P56161|ACES_ANOST Acetylcholinesterase OS=Anopheles stephensi PE=3 SV=1 24 117 8.0E-09
sp|B0F2B4|NLGN4_MOUSE Neuroligin 4-like OS=Mus musculus GN=Nlgn4l PE=1 SV=1 32 143 8.0E-09
sp|P12992|ESTJ_HELVI Juvenile hormone esterase OS=Heliothis virescens PE=1 SV=2 11 139 8.0E-09
sp|Q8N2Q7|NLGN1_HUMAN Neuroligin-1 OS=Homo sapiens GN=NLGN1 PE=1 SV=2 44 143 8.0E-09
sp|Q9NZ94|NLGN3_HUMAN Neuroligin-3 OS=Homo sapiens GN=NLGN3 PE=1 SV=2 3 115 1.0E-08
sp|O16168|EST5A_DROMI Esterase-5A OS=Drosophila miranda GN=Est-5A PE=3 SV=1 2 139 1.0E-08
sp|O16173|EST5A_DROPE Esterase-5A OS=Drosophila persimilis GN=Est-5A PE=3 SV=1 2 139 1.0E-08
sp|P10959|EST1C_RAT Carboxylesterase 1C OS=Rattus norvegicus GN=Ces1c PE=1 SV=3 32 126 1.0E-08
sp|P25727|EST5A_DROPS Esterase-5A OS=Drosophila pseudoobscura pseudoobscura GN=Est-5A PE=3 SV=3 2 139 2.0E-08
sp|P81429|EST1_SCHGA Esterase SG1 (Fragment) OS=Schizaphis graminum GN=SG1 PE=1 SV=1 5 135 2.0E-08
sp|Q62765|NLGN1_RAT Neuroligin-1 OS=Rattus norvegicus GN=Nlgn1 PE=1 SV=1 44 143 2.0E-08
sp|P21837|CRYS_DICDI Crystal protein OS=Dictyostelium discoideum GN=cryS PE=1 SV=1 26 138 5.0E-08
sp|P06882|THYG_RAT Thyroglobulin OS=Rattus norvegicus GN=Tg PE=1 SV=4 39 144 6.0E-08
sp|P01266|THYG_HUMAN Thyroglobulin OS=Homo sapiens GN=TG PE=1 SV=5 44 128 1.0E-07
sp|P30122|CEL_BOVIN Bile salt-activated lipase (Fragment) OS=Bos taurus GN=CEL PE=1 SV=2 32 138 1.0E-07
sp|D4ASH1|LIP1_ARTBC Secreted lipase ARB07186/07185 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07185 PE=1 SV=2 42 135 2.0E-07
sp|Q69ZK9|NLGN2_MOUSE Neuroligin-2 OS=Mus musculus GN=Nlgn2 PE=1 SV=2 44 143 2.0E-07
sp|Q62888|NLGN2_RAT Neuroligin-2 OS=Rattus norvegicus GN=Nlgn2 PE=1 SV=1 44 143 2.0E-07
sp|Q8NFZ4|NLGN2_HUMAN Neuroligin-2 OS=Homo sapiens GN=NLGN2 PE=1 SV=1 44 143 2.0E-07
sp|Q05487|ESTS_DROVI Esterase S OS=Drosophila virilis GN=EstS PE=2 SV=1 10 137 3.0E-07
sp|P18167|ESTP_DROME Esterase P OS=Drosophila melanogaster GN=Est-P PE=2 SV=2 10 138 4.0E-07
sp|Q8R0W5|EST4A_MOUSE Carboxylesterase 4A OS=Mus musculus GN=Ces4a PE=2 SV=2 35 143 5.0E-07
sp|P07882|CEL_RAT Bile salt-activated lipase OS=Rattus norvegicus GN=Cel PE=1 SV=2 39 136 2.0E-06
sp|O08710|THYG_MOUSE Thyroglobulin OS=Mus musculus GN=Tg PE=1 SV=3 39 144 1.0E-05
sp|P19835|CEL_HUMAN Bile salt-activated lipase OS=Homo sapiens GN=CEL PE=1 SV=3 32 136 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|636550
MLLVVVQFFLALTHISATPTPNSSLEIHLPTGTFRGFSVAGSGVDQWLGIPFAEPPIGPLRFKAPVPITASGEPG
AVKNATEFGNACPQLENDGLGPPNAPISEDCLFLNVYRPSGSGDDLPVLFWLHGGAWNTGAASQTDPSGE*
Coding >Agabi119p4|636550
ATGCTCTTAGTAGTCGTTCAATTTTTCCTTGCATTAACTCATATTTCAGCTACACCAACACCAAACTCCAGTCTC
GAAATACACCTACCAACAGGAACCTTTCGCGGGTTTTCAGTTGCAGGATCCGGCGTAGATCAATGGCTCGGTATA
CCCTTTGCTGAACCACCTATCGGACCATTACGCTTTAAAGCTCCTGTACCAATCACAGCATCAGGGGAACCTGGG
GCGGTTAAGAATGCTACTGAATTTGGCAACGCCTGTCCGCAACTGGAGAATGATGGACTTGGTCCCCCTAATGCA
CCTATTAGTGAGGACTGCTTGTTCTTAAATGTGTATCGTCCATCCGGGTCGGGAGATGACCTGCCCGTTTTGTTC
TGGTTACATGGTGGCGCTTGGAATACGGGAGCTGCCTCGCAAACCGACCCCAGTGGTGAGTGA
Transcript >Agabi119p4|636550
ATGCTCTTAGTAGTCGTTCAATTTTTCCTTGCATTAACTCATATTTCAGCTACACCAACACCAAACTCCAGTCTC
GAAATACACCTACCAACAGGAACCTTTCGCGGGTTTTCAGTTGCAGGATCCGGCGTAGATCAATGGCTCGGTATA
CCCTTTGCTGAACCACCTATCGGACCATTACGCTTTAAAGCTCCTGTACCAATCACAGCATCAGGGGAACCTGGG
GCGGTTAAGAATGCTACTGAATTTGGCAACGCCTGTCCGCAACTGGAGAATGATGGACTTGGTCCCCCTAATGCA
CCTATTAGTGAGGACTGCTTGTTCTTAAATGTGTATCGTCCATCCGGGTCGGGAGATGACCTGCCCGTTTTGTTC
TGGTTACATGGTGGCGCTTGGAATACGGGAGCTGCCTCGCAAACCGACCCCAGTGGTGAGTGA
Gene >Agabi119p4|636550
ATGCTCTTAGTAGTCGTTCAATTTTTCCTTGCATTAACTCATATTTCAGCTACACCAACACCAAACTCCAGTCTC
GAAATACACCTACCAACAGGAACCTTTCGCGGGTTTTCAGTTGCAGGATCCGGCGTAGATCAATGGCTCGGTATA
CCCTTTGCTGAACCACCTATCGGACCATTACGCTTTAAAGCTCCTGTACCAATCACAGCATCAGGGGAACCTGGG
GCGGTTAAGAATGCTACTGAATTTGGCAACGCCTGTCCGCAACTGGAGAATGATGGACTTGGTCCCCCTAATGCA
CCTATTAGTGAGGACTGCTTGTTCTTAAATGTAATTCTAGTCTTGTTGTTGTTATCGATAATGGTTGCTGATTCC
TGGTGAAAGGTGTATCGTCCATCCGGGTCGGGAGATGACCTGCCCGTTTTGTTCTGGTTACATGTAAGAACGTTT
GTATCAATTAAACCCCTTACGCCAAACTGAGATGAGATATAGGGTGGCGCTTGGAATACGGGGTAAGCACGAAAT
AATGTTTTCTTGTACACTCAAGTCTCAGACGTGGAAGCACAGAGCTGCCTCGCAAACCGACCCCAGTGGTGAGTG
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail