Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|633100
Gene name
Locationscaffold_04:3029800..3031608
Strand-
Gene length (bp)1808
Transcript length (bp)1227
Coding sequence length (bp)1227
Protein length (aa) 409

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00544 Pectate_lyase_4 Pectate lyase 2.4E-33 175 342

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WIT0|PLYA_ASPFU Probable pectate lyase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=plyA PE=3 SV=1 93 408 1.0E-103
sp|B0XT32|PLYA_ASPFC Probable pectate lyase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=plyA PE=3 SV=1 93 408 1.0E-103
sp|A2QV36|PLYA_ASPNC Probable pectate lyase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=plyA PE=3 SV=1 109 408 4.0E-103
sp|Q9C2Z0|PLYA_ASPNG Pectate lyase A OS=Aspergillus niger GN=plyA PE=1 SV=1 109 408 7.0E-103
sp|A1CYB8|PLYA_NEOFI Probable pectate lyase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=plyA PE=3 SV=1 93 408 1.0E-102
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WIT0|PLYA_ASPFU Probable pectate lyase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=plyA PE=3 SV=1 93 408 1.0E-103
sp|B0XT32|PLYA_ASPFC Probable pectate lyase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=plyA PE=3 SV=1 93 408 1.0E-103
sp|A2QV36|PLYA_ASPNC Probable pectate lyase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=plyA PE=3 SV=1 109 408 4.0E-103
sp|Q9C2Z0|PLYA_ASPNG Pectate lyase A OS=Aspergillus niger GN=plyA PE=1 SV=1 109 408 7.0E-103
sp|A1CYB8|PLYA_NEOFI Probable pectate lyase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=plyA PE=3 SV=1 93 408 1.0E-102
sp|Q5AVN4|PLYA_EMENI Pectate lyase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=plyA PE=1 SV=1 113 408 2.0E-98
sp|Q2U8R6|PLYA_ASPOR Probable pectate lyase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=plyA PE=3 SV=1 91 408 1.0E-97
sp|B8NE46|PLYA_ASPFN Probable pectate lyase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=plyA PE=3 SV=1 91 408 1.0E-97
sp|O59939|PLYB_COLGL Pectate lyase B OS=Colletotrichum gloeosporioides GN=PLB PE=3 SV=1 150 408 3.0E-84
sp|Q2TZY0|PLYB_ASPOR Probable pectate lyase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=plyB PE=3 SV=1 93 406 6.0E-73
sp|B8NBC2|PLYB_ASPFN Probable pectate lyase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=plyB PE=3 SV=1 93 406 6.0E-73
sp|Q0CBV0|PLYB_ASPTN Probable pectate lyase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=plyB PE=3 SV=1 92 406 1.0E-70
sp|Q00645|PLYB_EMENI Pectate lyase plyB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=plyB PE=1 SV=1 89 406 2.0E-69
sp|B1B6T1|PTLY_BACSP Pectate trisaccharide-lyase OS=Bacillus sp. GN=pel PE=1 SV=1 119 403 1.0E-46
sp|Q8GCB2|PTLY_BACLI Pectate trisaccharide-lyase OS=Bacillus licheniformis GN=pelA PE=1 SV=1 119 403 1.0E-46
sp|Q65DC2|PTLY_BACLD Pectate trisaccharide-lyase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=BLi04129 PE=3 SV=1 119 403 1.0E-46
sp|Q12639|PELA_PEYPI Pectin lyase OS=Peyronellaea pinodes GN=PELA PE=3 SV=1 217 305 1.0E-33
sp|P0C1A5|PLYE_DICD3 Pectate lyase E OS=Dickeya dadantii (strain 3937) GN=pelE PE=3 SV=2 92 397 9.0E-28
sp|P0C1A4|PLYE2_DICCH Pectate lyase E OS=Dickeya chrysanthemi GN=pelE PE=3 SV=1 92 344 3.0E-27
sp|P04960|PLYE1_DICCH Pectate lyase E OS=Dickeya chrysanthemi GN=pelE PE=1 SV=1 92 321 5.0E-25
sp|P18209|PLYD_DICCH Pectate lyase D OS=Dickeya chrysanthemi GN=pelD PE=3 SV=1 88 321 6.0E-25
sp|P0C1A2|PLYA_DICCH Pectate lyase A OS=Dickeya chrysanthemi GN=pelA PE=1 SV=1 91 325 2.0E-22
sp|Q9WYR4|PTLY_THEMA Pectate trisaccharide-lyase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=pelA PE=1 SV=1 116 343 1.0E-21
sp|B1L969|PTLY_THESQ Pectate trisaccharide-lyase OS=Thermotoga sp. (strain RQ2) GN=pelA PE=3 SV=1 116 343 5.0E-21
sp|P0C1A3|PLYA_DICD3 Pectate lyase A OS=Dickeya dadantii (strain 3937) GN=pelA PE=3 SV=1 95 324 6.0E-21
sp|P24112|PELD_PECCA Pectin lyase OS=Pectobacterium carotovorum GN=pnl PE=1 SV=1 135 403 7.0E-21
sp|Q60140|PLY_PSEVI Pectate lyase OS=Pseudomonas viridiflava GN=pel PE=3 SV=1 96 319 2.0E-20
sp|Q51915|PLY_PSEMA Pectate lyase OS=Pseudomonas marginalis GN=pel PE=1 SV=1 121 319 1.0E-19
sp|Q59671|PLY_PSEFL Pectate lyase OS=Pseudomonas fluorescens GN=pel PE=3 SV=1 121 319 3.0E-17
sp|P15721|PLY56_SOLLC Probable pectate lyase P56 OS=Solanum lycopersicum GN=LAT56 PE=2 SV=2 166 380 1.0E-16
sp|P72242|PLY_PSEAV Pectate lyase OS=Pseudomonas amygdali pv. lachrymans GN=pelP PE=3 SV=1 121 319 2.0E-16
sp|Q56806|PLY_XANCM Pectate lyase OS=Xanthomonas campestris pv. malvacearum PE=3 SV=1 121 403 8.0E-16
sp|P0C1C0|PLY1_PECCA Pectate lyase 1 OS=Pectobacterium carotovorum GN=pel1 PE=1 SV=1 126 403 4.0E-15
sp|P04959|PLYB_DICCH Pectate lyase B OS=Dickeya chrysanthemi GN=pelB PE=3 SV=1 182 403 3.0E-14
sp|P81294|PLY1_JUNAS Pectate lyase 1 OS=Juniperus ashei PE=1 SV=1 191 348 5.0E-14
sp|Q9SCG9|PLY1_HESAR Pectate lyase 1 OS=Hesperocyparis arizonica PE=1 SV=2 188 346 7.0E-14
sp|Q9FM66|PLY21_ARATH Putative pectate lyase 21 OS=Arabidopsis thaliana GN=At5g55720 PE=3 SV=1 193 385 8.0E-14
sp|Q6CZT2|PLY3_PECAS Pectate lyase 3 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=pel3 PE=3 SV=1 171 405 9.0E-14
sp|P0C1C3|PLY3_PECCC Pectate lyase 3 OS=Pectobacterium carotovorum subsp. carotovorum GN=pel3 PE=3 SV=1 110 405 1.0E-13
sp|Q9LLT1|PLY1_JUNVI Pectate lyase 1 OS=Juniperus virginiana PE=1 SV=1 188 346 2.0E-13
sp|P0C1C2|PLY3_PECCA Pectate lyase 3 OS=Pectobacterium carotovorum GN=pel3 PE=1 SV=1 182 405 2.0E-13
sp|O34819|PEL1_BACSU Pectin lyase OS=Bacillus subtilis (strain 168) GN=pelB PE=3 SV=1 133 403 3.0E-13
sp|P94449|PEL2_BACIU Pectin lyase OS=Bacillus subtilis GN=pelB PE=1 SV=1 134 403 3.0E-13
sp|P0C1C1|PLY2_PECCA Pectate lyase 2 OS=Pectobacterium carotovorum GN=pel2 PE=3 SV=1 182 345 8.0E-13
sp|Q96385|PLY1_CHAOB Pectate lyase 1 OS=Chamaecyparis obtusa PE=1 SV=1 195 346 1.0E-12
sp|P40972|PLY_TOBAC Pectate lyase OS=Nicotiana tabacum PE=2 SV=1 168 321 1.0E-12
sp|Q6CZT3|PLY2_PECAS Pectate lyase 2 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=pel2 PE=1 SV=1 126 345 1.0E-12
sp|P11073|PLYC_DICCH Pectate lyase C OS=Dickeya chrysanthemi GN=pelC PE=1 SV=1 182 403 1.0E-12
sp|P18632|PLY1_CRYJA Pectate lyase 1 OS=Cryptomeria japonica PE=1 SV=3 195 346 1.0E-12
sp|P27027|PELD_PSEMA Pectin lyase OS=Pseudomonas marginalis GN=pnl PE=1 SV=2 126 403 3.0E-12
sp|P27762|PLY4_AMBAR Pectate lyase 4 OS=Ambrosia artemisiifolia PE=1 SV=1 195 322 9.0E-12
sp|B3GQR3|PELE_ASPNG Probable pectin lyase E OS=Aspergillus niger GN=pelE PE=3 SV=1 124 345 1.0E-11
sp|P39116|PLY_BACSU Pectate lyase OS=Bacillus subtilis (strain 168) GN=pel PE=1 SV=1 174 322 1.0E-11
sp|Q2UJA7|PELF_ASPOR Probable pectin lyase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pelF PE=3 SV=2 175 345 2.0E-11
sp|B8N316|PELF_ASPFN Probable pectin lyase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=pelF PE=3 SV=1 175 345 2.0E-11
sp|Q9C8G4|PLY4_ARATH Probable pectate lyase 4 OS=Arabidopsis thaliana GN=At1g30350 PE=2 SV=1 189 349 3.0E-11
sp|O65388|PLY2_ARATH Putative pectate lyase 2 OS=Arabidopsis thaliana GN=At1g11920 PE=3 SV=2 219 359 3.0E-11
sp|O65456|PLY16_ARATH Probable pectate lyase 16 OS=Arabidopsis thaliana GN=At4g22080 PE=2 SV=1 219 322 5.0E-11
sp|Q9FXD8|PLY5_ARATH Probable pectate lyase 5 OS=Arabidopsis thaliana GN=At1g67750 PE=2 SV=2 219 321 6.0E-11
sp|Q9LTZ0|PLY11_ARATH Putative pectate lyase 11 OS=Arabidopsis thaliana GN=At3g27400 PE=3 SV=2 219 321 7.0E-11
sp|P24396|PLY18_SOLLC Probable pectate lyase P18 OS=Solanum lycopersicum GN=9612 PE=2 SV=1 219 321 1.0E-10
sp|O65457|PLY17_ARATH Putative pectate lyase 17 OS=Arabidopsis thaliana GN=At4g22090 PE=3 SV=1 219 322 1.0E-10
sp|O24554|PLY_ZINVI Pectate lyase OS=Zinnia violacea PE=1 SV=1 219 321 3.0E-10
sp|P27761|PLY2_AMBAR Pectate lyase 2 OS=Ambrosia artemisiifolia PE=1 SV=1 219 322 4.0E-10
sp|Q6CZT4|PLY1_PECAS Pectate lyase 1 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=pel1 PE=1 SV=1 182 403 7.0E-10
sp|O64510|PLY6_ARATH Probable pectate lyase 6 OS=Arabidopsis thaliana GN=At2g02720 PE=2 SV=1 193 321 9.0E-10
sp|Q9M9S2|PLY3_ARATH Probable pectate lyase 3 OS=Arabidopsis thaliana GN=AT59 PE=2 SV=1 190 321 1.0E-09
sp|Q93Z25|PLY22_ARATH Probable pectate lyase 22 OS=Arabidopsis thaliana GN=At5g63180 PE=2 SV=1 213 321 1.0E-09
sp|P15722|PLY59_SOLLC Probable pectate lyase P59 OS=Solanum lycopersicum GN=LAT59 PE=2 SV=1 190 321 1.0E-09
sp|Q944R1|PLY15_ARATH Probable pectate lyase 15 OS=Arabidopsis thaliana GN=At4g13710 PE=2 SV=1 213 321 2.0E-09
sp|Q9SVQ6|PLY14_ARATH Putative pectate lyase 14 OS=Arabidopsis thaliana GN=At4g13210 PE=2 SV=2 213 321 3.0E-09
sp|P22864|PELD_ASPNG Pectin lyase D OS=Aspergillus niger GN=pelD PE=1 SV=1 170 407 3.0E-09
sp|Q9LJ42|PLY10_ARATH Probable pectate lyase 10 OS=Arabidopsis thaliana GN=At3g24670 PE=2 SV=2 213 321 4.0E-09
sp|A2RBL2|PELD_ASPNC Probable pectin lyase D OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pelD PE=3 SV=1 170 407 4.0E-09
sp|Q8NJK6|PELF_ASPNG Probable pectin lyase F OS=Aspergillus niger GN=pelF PE=3 SV=1 175 342 4.0E-09
sp|A2R6A1|PELF_ASPNC Probable pectin lyase F OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pelF PE=3 SV=1 175 342 4.0E-09
sp|Q9SCP2|PLY12_ARATH Probable pectate lyase 12 OS=Arabidopsis thaliana GN=At3g53190 PE=2 SV=2 219 321 4.0E-09
sp|P27760|PLY1_AMBAR Pectate lyase 1 OS=Ambrosia artemisiifolia PE=1 SV=1 219 322 6.0E-09
sp|Q9C5M8|PLY18_ARATH Probable pectate lyase 18 OS=Arabidopsis thaliana GN=At4g24780 PE=2 SV=2 213 321 6.0E-09
sp|Q2TXM4|PELA_ASPOR Probable pectin lyase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pelA PE=3 SV=1 175 345 6.0E-09
sp|Q9LRM5|PLY9_ARATH Probable pectate lyase 9 OS=Arabidopsis thaliana GN=At3g24230 PE=2 SV=1 219 321 7.0E-09
sp|Q93Z04|PLY13_ARATH Probable pectate lyase 13 OS=Arabidopsis thaliana GN=PMR6 PE=1 SV=1 219 321 8.0E-09
sp|Q940Q1|PLY1_ARATH Probable pectate lyase 1 OS=Arabidopsis thaliana GN=At1g04680 PE=2 SV=2 213 321 2.0E-08
sp|P27759|PLY5_AMBAR Pectate lyase 5 OS=Ambrosia artemisiifolia PE=1 SV=1 195 322 2.0E-08
sp|P40973|PLY_LILLO Pectate lyase OS=Lilium longiflorum PE=2 SV=1 219 321 3.0E-08
sp|Q9SRH4|PLY7_ARATH Probable pectate lyase 7 OS=Arabidopsis thaliana GN=At3g01270 PE=2 SV=1 114 321 5.0E-08
sp|Q5B3J8|PELF_EMENI Probable pectin lyase F OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pelF PE=3 SV=1 175 366 5.0E-08
sp|Q9M8Z8|PLY8_ARATH Probable pectate lyase 8 OS=Arabidopsis thaliana GN=At3g07010 PE=2 SV=1 213 321 8.0E-08
sp|Q0CZD4|PELF2_ASPTN Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pelF-2 PE=3 SV=1 170 366 8.0E-08
sp|Q2TXS4|PELD_ASPOR Pectin lyase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pel2 PE=1 SV=1 170 345 8.0E-08
sp|B8NVB7|PELD_ASPFN Probable pectin lyase D OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=pelD PE=3 SV=1 170 345 8.0E-08
sp|Q9LFP5|PLY19_ARATH Probable pectate lyase 19 OS=Arabidopsis thaliana GN=At5g15110 PE=2 SV=1 213 353 9.0E-08
sp|A2QFN7|PELB_ASPNC Probable pectin lyase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pelB PE=3 SV=1 175 352 2.0E-07
sp|A1CFS2|PELA_ASPCL Probable pectin lyase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=pelA PE=3 SV=1 175 345 2.0E-07
sp|Q00205|PELB_ASPNG Pectin lyase B OS=Aspergillus niger GN=pelB PE=1 SV=1 175 343 3.0E-07
sp|Q93WF1|PLY20_ARATH Probable pectate lyase 20 OS=Arabidopsis thaliana GN=At5g48900 PE=2 SV=1 213 321 3.0E-07
sp|Q5BA61|PELB_EMENI Pectin lyase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pelB PE=2 SV=1 175 345 3.0E-07
sp|Q2TWM1|PELB_ASPOR Pectin lyase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pel1 PE=2 SV=1 175 345 5.0E-07
sp|Q5AQJ1|PELD_EMENI Probable pectin lyase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pelD PE=3 SV=1 175 345 7.0E-07
sp|Q4WIS6|PELB_ASPFU Probable pectin lyase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pelB PE=3 SV=1 175 345 8.0E-07
sp|B0XT36|PELA_ASPFC Probable pectin lyase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=pelA PE=3 SV=1 175 345 8.0E-07
sp|Q4WV10|PELA_ASPFU Probable pectin lyase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pelA PE=3 SV=1 175 345 1.0E-06
sp|Q5BAU9|PELA_EMENI Pectin lyase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pelA PE=1 SV=2 170 345 2.0E-06
sp|Q0CYL8|PELA_ASPTN Probable pectin lyase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pelA PE=3 SV=1 175 404 2.0E-06
sp|A2R3I1|PELA_ASPNC Probable pectin lyase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pelA PE=3 SV=1 175 345 5.0E-06
sp|Q01172|PELA_ASPNG Pectin lyase A OS=Aspergillus niger GN=pelA PE=1 SV=1 175 345 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|633100
MFNWFRLNFSLSRPSKYVSIRRRIPTFCSSRIQTYWRRPPRAGRTALYLQKNSISSPAVRPVDQKRRVKVFQEDL
STRTWLSSSDSTAFCSTMRILASIVAFAAVQLAAAGTIQRRASVNDVANLGYATLNGGTSGGSGGSQTTVTTLDQ
LTSAVSGDSRKIVLISGRISGSAVVRVGSNTSILGQPGSLLDGVGLRVLGESNVIIRNVKISRVVADVGDALGIQ
EAHQVWVDHVDLSSDRDHDKDFYDGLLDITHGCTGITVTNSRLHDHWKGSLVGHSDSNGSEDTPMTVTYANNWWH
NLNSRTPSFRFGHGHIFNNVFDANADGINTRDGAQLLVENNVWTNPAKQKPLYSTDGGFAVARGNDFGGGENTAP
AGNFNSPPYSYSLQSTTTTRSNVPNTAGQNLSF*
Coding >Agabi119p4|633100
ATGTTTAACTGGTTCCGTCTGAACTTCTCCCTGAGTCGGCCAAGTAAATACGTTTCTATTCGGCGAAGAATACCT
ACCTTTTGTTCGTCGCGTATACAGACATATTGGAGAAGACCGCCAAGGGCCGGGCGGACCGCTCTTTATTTGCAG
AAGAATTCAATCTCATCGCCAGCTGTCAGGCCTGTCGATCAGAAACGGCGGGTTAAGGTGTTCCAGGAAGACCTT
TCAACCAGAACTTGGTTGTCATCTTCTGACTCTACTGCTTTCTGCTCAACAATGAGGATTCTCGCTTCTATTGTG
GCTTTCGCCGCTGTTCAACTTGCTGCTGCCGGTACCATTCAAAGGCGTGCATCCGTCAATGACGTTGCTAATCTT
GGTTACGCAACTCTCAACGGAGGAACATCAGGTGGTTCAGGCGGGTCACAAACTACTGTGACTACTCTTGACCAA
TTGACCAGCGCTGTCAGTGGCGACAGCAGAAAAATTGTCCTCATTTCTGGCCGCATCTCTGGTAGTGCTGTTGTT
AGGGTAGGGTCCAACACTTCAATTCTTGGACAACCTGGATCCCTTCTTGACGGTGTTGGGCTCCGTGTTCTTGGG
GAGAGCAATGTCATCATTCGCAACGTCAAGATCTCCAGGGTCGTTGCTGATGTCGGCGATGCCCTTGGCATTCAA
GAAGCTCACCAAGTCTGGGTTGACCACGTTGACCTTTCCAGCGACAGGGACCACGACAAAGACTTCTACGACGGC
CTTCTTGACATCACCCACGGATGCACGGGTATCACTGTCACGAACTCCAGGCTCCACGACCACTGGAAAGGCTCT
CTCGTCGGTCATTCTGACAGTAACGGCAGCGAAGACACGCCTATGACCGTAACCTATGCCAACAATTGGTGGCAC
AACCTCAACTCTCGTACCCCCTCTTTCCGGTTTGGTCATGGCCACATCTTCAACAATGTCTTCGACGCCAACGCC
GATGGTATCAACACTCGTGATGGTGCTCAGCTGCTCGTTGAAAACAATGTTTGGACGAACCCTGCGAAGCAGAAG
CCTCTCTATTCTACTGACGGAGGCTTCGCTGTTGCTCGTGGCAATGATTTCGGTGGAGGTGAAAACACGGCTCCG
GCAGGCAACTTCAATAGCCCTCCCTACAGCTACAGTCTCCAATCCACGACTACCACGCGTAGCAATGTCCCTAAC
ACAGCCGGCCAAAACTTGAGCTTCTGA
Transcript >Agabi119p4|633100
ATGTTTAACTGGTTCCGTCTGAACTTCTCCCTGAGTCGGCCAAGTAAATACGTTTCTATTCGGCGAAGAATACCT
ACCTTTTGTTCGTCGCGTATACAGACATATTGGAGAAGACCGCCAAGGGCCGGGCGGACCGCTCTTTATTTGCAG
AAGAATTCAATCTCATCGCCAGCTGTCAGGCCTGTCGATCAGAAACGGCGGGTTAAGGTGTTCCAGGAAGACCTT
TCAACCAGAACTTGGTTGTCATCTTCTGACTCTACTGCTTTCTGCTCAACAATGAGGATTCTCGCTTCTATTGTG
GCTTTCGCCGCTGTTCAACTTGCTGCTGCCGGTACCATTCAAAGGCGTGCATCCGTCAATGACGTTGCTAATCTT
GGTTACGCAACTCTCAACGGAGGAACATCAGGTGGTTCAGGCGGGTCACAAACTACTGTGACTACTCTTGACCAA
TTGACCAGCGCTGTCAGTGGCGACAGCAGAAAAATTGTCCTCATTTCTGGCCGCATCTCTGGTAGTGCTGTTGTT
AGGGTAGGGTCCAACACTTCAATTCTTGGACAACCTGGATCCCTTCTTGACGGTGTTGGGCTCCGTGTTCTTGGG
GAGAGCAATGTCATCATTCGCAACGTCAAGATCTCCAGGGTCGTTGCTGATGTCGGCGATGCCCTTGGCATTCAA
GAAGCTCACCAAGTCTGGGTTGACCACGTTGACCTTTCCAGCGACAGGGACCACGACAAAGACTTCTACGACGGC
CTTCTTGACATCACCCACGGATGCACGGGTATCACTGTCACGAACTCCAGGCTCCACGACCACTGGAAAGGCTCT
CTCGTCGGTCATTCTGACAGTAACGGCAGCGAAGACACGCCTATGACCGTAACCTATGCCAACAATTGGTGGCAC
AACCTCAACTCTCGTACCCCCTCTTTCCGGTTTGGTCATGGCCACATCTTCAACAATGTCTTCGACGCCAACGCC
GATGGTATCAACACTCGTGATGGTGCTCAGCTGCTCGTTGAAAACAATGTTTGGACGAACCCTGCGAAGCAGAAG
CCTCTCTATTCTACTGACGGAGGCTTCGCTGTTGCTCGTGGCAATGATTTCGGTGGAGGTGAAAACACGGCTCCG
GCAGGCAACTTCAATAGCCCTCCCTACAGCTACAGTCTCCAATCCACGACTACCACGCGTAGCAATGTCCCTAAC
ACAGCCGGCCAAAACTTGAGCTTCTGA
Gene >Agabi119p4|633100
ATGTTTAACTGGTTCCGTCTGAACTTCTCCCTGAGTCGGCCAAGTAAATACGTTTCTATTCGGCGAAGAATACCT
AGTAAGTCTGAGATGTTCATACAAACGCGCTGCTTCTCGGAAAAATCTGATTTTTCCATGATACTCGTCTCCACA
TGATAAAATTATCCTTCAAGCCACGTCACATTCTCACAGCAAGTGCCCTCATTGCTCACGGTGTTGTTTGTCCAC
ACGCAATAGCCTTTTGTTCGTCGCGTATACAGACATATTGGAGAAGACCGCCAAGGGCCGGGCGGACCGCTCTTT
ATTTGCAGAAGAATTCAATCTCATCGCCAGCTGTCAGGCCTGTCGATCAGAAACGGCGGGTGTCAGTGAGATCTG
GGCTAATTACCTGGTGTGGAGGTCAGCTGGTGACGATCCTGATTTGAAAACTTTGCTATGGTCGTATGCTACTGA
GTGGTATAAAAAGTAAGGTGTTCCAGGAAGACCTTTCAACCAGAACTTGGTTGTCATCTTCTGACTCTACTGCTT
TCTGCTCAACAATGAGGATTCTCGCTTCTATTGTGGCTTTCGCCGCTGTTCAACTTGCTGCTGTATGTATATAAC
CTTCATGTCTTGAATCTGGATGAACGCTGAATCTGCTTGCTTGTCAGGCCGGTACCATTCAAAGGCGTGCATCCG
TCAATGACGTTGCTAATCTTGGTTACGCAACTCTCAACGGAGGGTATGTTTTTTGCACAGAGGATTGGATAGACT
ACTGACCATAATTAAATTAGAACATCAGGTGGTTCAGGCGGGTCACAAACTACTGTGACTACTCTTGACCAATTG
ACCAGCGCTGTCAGTGGCGACAGCAGAAAAATTGTCCTCATTTCTGGTATGGTCCTTTTTCTCTTTCTTGAAATC
TATATATCCTTATTCATAACGTGGAGGCCGCATCTCTGGTAGTGCTGTTGTTAGGGTAGGGTCCAACACTTCAAT
TCTTGGACAACCTGGATCCCGTACGTGCACATTGCTGTTTTCTCAAAGTGACATATGACAAATATTACTAGTTCT
TGACGGTGTTGGGCTCCGTGTTCTTGGGGAGAGCAATGTCATCATTCGCAACGTCAAGATCTCCAGGGTCGTTGC
TGATGTCGGCGATGCCCTTGGCATTCAAGAAGCTCACCAAGTCTGGGTTGACCACGTTGACCTTTCCAGCGACAG
GGACCACGACAAAGACTTGTGGGTCAGACAAGCCGCTTCCAATTTCTTTAATTCAATTGTGTTTCCAGCTACGAC
GGCCTTCTTGACATCACCCACGGATGCACGGGTATCACTGTCACGAACTCCAGGCTCCACGACCACTGGAAAGGC
TCTCTCGTCGGTCATTCTGACAGTAACGGCAGCGAAGACACGCCTATGACCGTAACCTATGCCAACAATTGGTGG
CACAACCTCAACTCTCGTACCCCCTCTTTCCGGTTTGGTCATGGCCACATCTTCAACAATGTCTTCGACGCCAAC
GCCGATGGTATCAACACTCGTGATGGTGCTCAGCTGCTCGTTGAAAACAATGTTTGGACGAGTACGTTTCCTGAT
TTTGCCACCGAAGCCCCAAGCTGATAAGGTTCCTTGTAGACCCTGCGAAGCAGAAGCCTCTCTATTCTACTGACG
GAGGCTTCGCTGTTGCTCGTGGCAATGATTTCGGTGGAGGTGAAAACACGGCTCCGGCAGGCAACTTCAATAGCC
CTCCCTACAGCTACAGTCTCCAATCCACGACTACCACGCGTAGCAATGTCCCTAACACAGCCGGCCAAAACTTGA
GCTTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail