Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|623850
Gene name
Locationscaffold_04:1533069..1533525
Strand-
Gene length (bp)456
Transcript length (bp)363
Coding sequence length (bp)363
Protein length (aa) 121

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17051 COA2 Cytochrome C oxidase assembly factor 2 6.0E-11 45 97

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|G2TRM8|COA2_SCHPO Cytochrome c oxidase assembly factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=coa2 PE=1 SV=1 44 95 4.0E-07

GO

GO Term Description Terminal node
GO:0033617 mitochondrial cytochrome c oxidase assembly Yes
GO:0033108 mitochondrial respiratory chain complex assembly No
GO:0008535 respiratory chain complex IV assembly No
GO:0016043 cellular component organization No
GO:0008150 biological_process No
GO:0071840 cellular component organization or biogenesis No
GO:0043933 protein-containing complex organization No
GO:0022607 cellular component assembly No
GO:0017004 cytochrome complex assembly No
GO:0009987 cellular process No
GO:0065003 protein-containing complex assembly No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 56 78 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|623850
MGGYTRTNNFIWFGGTNRKSLSIPSTQLRLWSWALRERVHRMSIYRILRLTQRRAFVSSLFGLTFVAAVVTVSAS
SILPCPARRNKDRYLDSNGDRSLVSEGPVNVAKRPRRWIEEKGPC*
Coding >Agabi119p4|623850
ATGGGAGGTTATACAAGAACAAACAACTTCATTTGGTTCGGCGGTACAAACCGGAAAAGTTTGTCTATACCATCC
ACACAACTTCGCTTGTGGTCATGGGCATTGCGTGAACGGGTCCATAGGATGTCCATTTACAGAATCCTTCGTCTA
ACACAACGTCGTGCATTTGTATCTTCGCTCTTCGGCCTCACTTTCGTTGCTGCTGTCGTCACAGTATCAGCTTCC
AGCATATTACCCTGCCCAGCGCGTCGTAACAAAGATAGATATTTGGACAGTAACGGAGATAGGTCACTGGTGTCG
GAGGGTCCTGTGAACGTTGCGAAGCGTCCGAGGAGGTGGATAGAAGAGAAAGGACCATGTTAA
Transcript >Agabi119p4|623850
ATGGGAGGTTATACAAGAACAAACAACTTCATTTGGTTCGGCGGTACAAACCGGAAAAGTTTGTCTATACCATCC
ACACAACTTCGCTTGTGGTCATGGGCATTGCGTGAACGGGTCCATAGGATGTCCATTTACAGAATCCTTCGTCTA
ACACAACGTCGTGCATTTGTATCTTCGCTCTTCGGCCTCACTTTCGTTGCTGCTGTCGTCACAGTATCAGCTTCC
AGCATATTACCCTGCCCAGCGCGTCGTAACAAAGATAGATATTTGGACAGTAACGGAGATAGGTCACTGGTGTCG
GAGGGTCCTGTGAACGTTGCGAAGCGTCCGAGGAGGTGGATAGAAGAGAAAGGACCATGTTAA
Gene >Agabi119p4|623850
ATGGGAGGTTATACAAGAACAAACAACTTCATTTGGTTCGGCGGTACAAACCGGAAAAGTTTGTCTATACCATCC
ACACAACTTCGCGTTTTCCTTGACTTGTCAAGCGCCCTTCTCTATCTAACCTTATAGTTGTGGTCATGGGCATTG
CGTGAACGGTTAGTCTTGATCTGCATCCTCAGCCATAATTTAACCGGAAAAAATAGGGTCCATAGGATGTCCATT
TACAGAATCCTTCGTCTAACACAACGTCGTGCATTTGTATCTTCGCTCTTCGGCCTCACTTTCGTTGCTGCTGTC
GTCACAGTATCAGCTTCCAGCATATTACCCTGCCCAGCGCGTCGTAACAAAGATAGATATTTGGACAGTAACGGA
GATAGGTCACTGGTGTCGGAGGGTCCTGTGAACGTTGCGAAGCGTCCGAGGAGGTGGATAGAAGAGAAAGGACCA
TGTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail