Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|623250
Gene name
Locationscaffold_04:1258118..1263399
Strand+
Gene length (bp)5281
Transcript length (bp)4179
Coding sequence length (bp)4179
Protein length (aa) 1393

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01214 CK_II_beta Casein kinase II regulatory subunit 1.8E-73 426 647
PF02537 CRCB CrcB-like protein, Camphor Resistance (CrcB) 9.2E-12 65 150
PF02537 CRCB CrcB-like protein, Camphor Resistance (CrcB) 1.2E-17 233 342
PF09335 SNARE_assoc SNARE associated Golgi protein 1.9E-16 1151 1285

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8TG12|CSK2B_NEUCR Casein kinase II subunit beta-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ckb-1 PE=2 SV=1 417 695 1.0E-76
sp|O94281|CSK2C_SCHPO Probable casein kinase II subunit beta-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC2G5.02c PE=3 SV=1 407 663 9.0E-72
sp|P28021|CSK2B_XENLA Casein kinase II subunit beta OS=Xenopus laevis GN=csnk2b PE=1 SV=1 422 652 3.0E-61
sp|P67874|CSK2B_RAT Casein kinase II subunit beta OS=Rattus norvegicus GN=Csnk2b PE=1 SV=1 422 652 3.0E-61
sp|P67873|CSK2B_RABIT Casein kinase II subunit beta OS=Oryctolagus cuniculus GN=CSNK2B PE=2 SV=1 422 652 3.0E-61
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8TG12|CSK2B_NEUCR Casein kinase II subunit beta-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ckb-1 PE=2 SV=1 417 695 1.0E-76
sp|O94281|CSK2C_SCHPO Probable casein kinase II subunit beta-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC2G5.02c PE=3 SV=1 407 663 9.0E-72
sp|P28021|CSK2B_XENLA Casein kinase II subunit beta OS=Xenopus laevis GN=csnk2b PE=1 SV=1 422 652 3.0E-61
sp|P67874|CSK2B_RAT Casein kinase II subunit beta OS=Rattus norvegicus GN=Csnk2b PE=1 SV=1 422 652 3.0E-61
sp|P67873|CSK2B_RABIT Casein kinase II subunit beta OS=Oryctolagus cuniculus GN=CSNK2B PE=2 SV=1 422 652 3.0E-61
sp|P67872|CSK2B_PIG Casein kinase II subunit beta OS=Sus scrofa GN=CSNK2B PE=2 SV=1 422 652 3.0E-61
sp|P67871|CSK2B_MOUSE Casein kinase II subunit beta OS=Mus musculus GN=Csnk2b PE=1 SV=1 422 652 3.0E-61
sp|P67870|CSK2B_HUMAN Casein kinase II subunit beta OS=Homo sapiens GN=CSNK2B PE=1 SV=1 422 652 3.0E-61
sp|P67869|CSK2B_CHICK Casein kinase II subunit beta OS=Gallus gallus GN=CSNK2B PE=2 SV=1 422 652 3.0E-61
sp|P67868|CSK2B_BOVIN Casein kinase II subunit beta OS=Bos taurus GN=CSNK2B PE=1 SV=1 422 652 3.0E-61
sp|Q91398|CSK2B_DANRE Casein kinase II subunit beta OS=Danio rerio GN=csnk2b PE=2 SV=1 422 652 3.0E-61
sp|P40228|CSK2B_ARATH Casein kinase II subunit beta OS=Arabidopsis thaliana GN=CKB1 PE=1 SV=1 407 594 2.0E-60
sp|P28548|CSK2B_CAEEL Casein kinase II subunit beta OS=Caenorhabditis elegans GN=kin-10 PE=1 SV=2 422 593 1.0E-59
sp|P40229|CSK2C_ARATH Casein kinase II subunit beta' OS=Arabidopsis thaliana GN=CKB2 PE=1 SV=1 411 593 1.0E-59
sp|O80507|CSK2E_ARATH Putative casein kinase II subunit beta-4 OS=Arabidopsis thaliana GN=At2g44680 PE=2 SV=1 406 651 4.0E-58
sp|O59906|CSK2B_CANAX Casein kinase II subunit beta OS=Candida albicans GN=CKB1 PE=1 SV=1 427 666 5.0E-58
sp|P43639|CSK2B_YEAST Casein kinase II subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CKB1 PE=1 SV=1 427 670 1.0E-57
sp|P08182|CSK2B_DROME Casein kinase II subunit beta OS=Drosophila melanogaster GN=CkIIbeta PE=2 SV=2 422 593 2.0E-56
sp|O81275|CSK2D_ARATH Casein kinase II subunit beta-3 OS=Arabidopsis thaliana GN=CKB3 PE=1 SV=1 406 650 2.0E-56
sp|Q54PF1|CK2B_DICDI Casein kinase II subunit beta OS=Dictyostelium discoideum GN=csnk2b PE=3 SV=1 411 653 5.0E-55
sp|P40232|CSK2B_SCHPO Casein kinase II subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ckb1 PE=2 SV=2 427 648 3.0E-54
sp|O96863|CSK2C_DROME Casein kinase II subunit beta' OS=Drosophila melanogaster GN=CkIIbeta2 PE=2 SV=1 420 652 2.0E-52
sp|O76485|CSK2B_SPOFR Casein kinase II subunit beta OS=Spodoptera frugiperda PE=2 SV=1 422 593 2.0E-51
sp|Q8TG11|CSK2C_NEUCR Casein kinase II subunit beta-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ckb-2 PE=2 SV=1 413 594 3.0E-45
sp|P38930|CSK2C_YEAST Casein kinase II subunit beta' OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CKB2 PE=1 SV=1 427 664 4.0E-45
sp|Q24536|SSL_DROME Suppressor-of-stellate-like protein OS=Drosophila melanogaster GN=Ssl PE=2 SV=1 426 656 5.0E-35
sp|Q9UTS8|YI7B_SCHPO UPF0695 membrane protein C977.11/PB8B6.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC977.11 PE=3 SV=1 67 355 5.0E-31
sp|Q7KV14|STEL3_DROME Stellate protein CG33238 OS=Drosophila melanogaster GN=Ste:CG33238 PE=1 SV=3 418 585 1.0E-24
sp|Q7KV22|STEL6_DROME Stellate protein CG33246 OS=Drosophila melanogaster GN=Ste:CG33246 PE=1 SV=2 427 585 1.0E-24
sp|Q7KV19|STEL5_DROME Stellate protein CG33243 OS=Drosophila melanogaster GN=Ste:CG33243 PE=1 SV=2 427 585 6.0E-24
sp|Q7KV15|STEL4_DROME Stellate protein CG33239/CG33241 OS=Drosophila melanogaster GN=Ste:CG33239 PE=1 SV=2 427 585 1.0E-23
sp|Q9NIV2|STEL8_DROME Stellate orphon protein at 12D OS=Drosophila melanogaster GN=Ste12DOR PE=1 SV=4 427 585 1.0E-23
sp|Q7KV13|STEL2_DROME Stellate protein CG33237 OS=Drosophila melanogaster GN=Ste:CG33237 PE=1 SV=2 427 585 1.0E-23
sp|Q7KV12|STEL1_DROME Stellate protein CG33236/CG33240/CG33244/CG33245 OS=Drosophila melanogaster GN=Ste:CG33236 PE=1 SV=2 427 585 1.0E-23
sp|Q7KV23|STEL7_DROME Stellate protein CG33247 OS=Drosophila melanogaster GN=Ste:CG33247 PE=1 SV=2 427 585 2.0E-23
sp|Q08991|YP279_YEAST UPF0695 membrane protein YPL279C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL279C PE=3 SV=1 68 352 1.0E-21
sp|Q08913|YO390_YEAST UPF0695 membrane protein YOR390W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR390W PE=3 SV=1 68 352 1.0E-20
sp|O62126|TM41_CAEEL Transmembrane protein 41 homolog OS=Caenorhabditis elegans GN=tag-175 PE=3 SV=1 1103 1333 2.0E-11
sp|Q8MXN7|TM41_DICDI Transmembrane protein 41 homolog OS=Dictyostelium discoideum GN=DDB_G0275543 PE=3 SV=2 1079 1333 1.0E-08
sp|Q502G2|T41AA_DANRE Transmembrane protein 41A-A OS=Danio rerio GN=tmem41aa PE=2 SV=1 1105 1353 6.0E-08
sp|Q96HV5|TM41A_HUMAN Transmembrane protein 41A OS=Homo sapiens GN=TMEM41A PE=1 SV=1 1104 1354 3.0E-07
sp|A4II98|TM41B_XENTR Transmembrane protein 41B OS=Xenopus tropicalis GN=tmem41b PE=2 SV=1 1108 1334 8.0E-07
sp|Q21Y62|CRCB_RHOFT Putative fluoride ion transporter CrcB OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=crcB PE=3 SV=2 226 316 1.0E-06
sp|Q9VX39|TM41_DROME Transmembrane protein 41 homolog OS=Drosophila melanogaster GN=stas PE=2 SV=2 1105 1333 1.0E-06
sp|Q08D99|TM41A_BOVIN Transmembrane protein 41A OS=Bos taurus GN=TMEM41A PE=2 SV=1 1104 1314 3.0E-06
sp|Q9D8U2|TM41A_MOUSE Transmembrane protein 41A OS=Mus musculus GN=Tmem41a PE=2 SV=1 1104 1306 3.0E-06
sp|Q5KWE9|CRCB1_GEOKA Putative fluoride ion transporter CrcB 1 OS=Geobacillus kaustophilus (strain HTA426) GN=crcB1 PE=3 SV=1 238 338 4.0E-06
sp|Q3AUE0|CRCB_CHLCH Putative fluoride ion transporter CrcB OS=Chlorobium chlorochromatii (strain CaD3) GN=crcB PE=3 SV=1 238 351 5.0E-06
sp|Q8K1A5|TM41B_MOUSE Transmembrane protein 41B OS=Mus musculus GN=Tmem41b PE=1 SV=1 1103 1334 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0019887 protein kinase regulator activity Yes
GO:0005956 protein kinase CK2 complex Yes
GO:0016021 integral component of membrane Yes
GO:0032991 protein-containing complex No
GO:0031224 intrinsic component of membrane No
GO:0140535 intracellular protein-containing complex No
GO:0019207 kinase regulator activity No
GO:0030234 enzyme regulator activity No
GO:0098772 molecular function regulator activity No
GO:0110165 cellular anatomical entity No
GO:0003674 molecular_function No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.5

Transmembrane Domains

Domain # Start End Length
1 55 77 22
2 87 108 21
3 115 137 22
4 166 188 22
5 201 220 19
6 230 252 22
7 259 281 22
8 294 316 22
9 329 351 22
10 1075 1097 22
11 1155 1174 19
12 1178 1200 22
13 1238 1260 22
14 1306 1328 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|623250
MSPEGDIPLRATPNDEERGSSGCDAASTTESAERIEQPPAEEEGIKLQYKIYPPLSFAVIALLAPASILGTLARL
GLLAMTEYNGQSIFSLAYVQALGCLIMGFALRLREPIGQFYGPFYTALTTGFCGSLTTFSSWQTDIFDSWINNEN
NRRSGFHSFIDGLGKSVFTLSFSLASVSFGYNMANLIAPYLPTFKFPRKAVRYSWTVLAVCMYAAVFPAYFQTSE
RIRCAATAALLFAFPGALTRYLLGIWLNQRSRALPLGTLFANLFGTALLGGLHVLQGLPNAVSPNACCILQGLGD
GYCACLTTVSTFAAEMRDLKWWKAVRYCIISWGAGQLLLVLIVGSSMWAGGVAKEATCSYHGSLLDNDERLIARQ
MASRQSMPPDIVQQPMDGEQVGVPGEGDEIMEEPEEQEDGYSSSTPTSTLTWICWFCSLPGHEYFCEVTEDFIED
DFNLTGLNNMVPFWKEAMEMVLDVEPDEDNSKIPDVSIVESSAEMLYGLVHQRFILTRAGLQAMLDKYDNNTFGV
CPRVYCMGTSVVPCGRSDIPGLDTVKLYCPNCNDLYVPPSSRFQGVDGAFFGTTFPHLFFQTYRELAPAPFWRPP
QVGEAQPSPRSSQGSNPRTSPFVNPNVNGGQKRAAGYVYVPRIYGFKVSERAKSGPRMQWLRLRPEDPEDLDAVD
WRGRWIDDEDDGYDDDLEDVVDRPMEDFDPDAMDGDEEEEEEEEEEEEASSTRDQGQQRSLVSLSPAASSARTSP
SSLGVPYTPQEKSPISPGMYTTSPVYSNASREKAVSAAMQHTSHPGPVSLRYLRPPQDLKKNGSKQSPFRTQQGP
PNDRHRAVCQTQPPQGCAINQNQICAVCYSGGGWILAVRASCAGVTEKLKGQESQEADQEEARRAGGRTRAGEGW
LDSDSAVLSTAAAYMLCSVDSSGRIEAKMEAMAESRVMSQTAYGSARVCRSGTGSPFFYSLMLASAPRPVSSSLS
PHHSLGRRRSSSSLLDAASDQQPLSTAVSHHQPTQSMIVVVVSRILQWLHLQPQHSLSWPSPSSPRSSTEKLVLP
LSASSQKTSFTDVPSEESRTHHFPSVHAPIVFVICLLPISTALVFYCTSTLPITLAWPRTLEDVAQLGRELTAYT
QSGTWPLLHVMGVMAITAIWKHAWSIPGSVIWNVLAGALFSPIIATLFLTTLTTIGSICATLLATPLAPFLTYLF
PRALDMTRTALHGESDNPQDDSTTEVHKSKSSAWVRLSVLRLVGVVPWSGINIACGVCGVSLGDCVMGAFIGCLP
WTAVTCQIGDILQTVVSTSSNSTPESISSILMSPRIIIKLALLSFLSLAPILARNRLRKMIHPSVFQSSPENEQS
SRRNWVRDLRTKISKTRSRDRKPSLKLNILVQEKRAIEELPS*
Coding >Agabi119p4|623250
ATGTCCCCAGAAGGGGACATTCCGTTACGCGCGACGCCGAACGATGAAGAACGAGGTTCATCTGGATGCGACGCA
GCTTCGACAACAGAATCTGCTGAACGCATTGAACAACCCCCAGCAGAAGAGGAAGGTATTAAGCTGCAATACAAA
ATCTATCCCCCACTTTCTTTTGCCGTTATCGCCCTTCTTGCACCGGCATCCATTCTTGGCACTCTCGCCCGTCTG
GGCCTCTTGGCCATGACAGAATATAATGGCCAATCGATATTCTCTCTGGCCTATGTTCAGGCTCTCGGGTGCCTT
ATCATGGGATTTGCTTTGAGATTGAGGGAGCCTATAGGCCAATTTTATGGCCCATTTTACACTGCATTGACAACA
GGTTTTTGCGGGTCTTTAACTACATTTTCAAGCTGGCAAACTGATATTTTCGATTCCTGGATAAATAATGAAAAT
AATCGTAGAAGCGGATTCCACAGTTTTATTGACGGCCTTGGAAAGTCGGTATTTACCCTTTCATTCTCTTTGGCG
TCCGTTTCTTTCGGATATAATATGGCGAATTTGATTGCTCCATATTTGCCTACTTTCAAATTTCCAAGGAAGGCA
GTGCGATATTCATGGACTGTACTCGCGGTCTGCATGTATGCGGCCGTCTTCCCTGCATATTTTCAAACGTCGGAG
CGGATCCGATGTGCAGCAACTGCGGCACTCCTGTTTGCGTTCCCAGGCGCCCTGACTCGATATCTCCTTGGAATA
TGGCTCAATCAGCGCAGTAGAGCATTGCCTCTAGGAACATTGTTCGCGAATCTGTTCGGGACGGCACTGCTAGGA
GGATTACACGTTCTGCAGGGTTTGCCGAATGCTGTATCGCCCAACGCGTGCTGTATATTACAAGGTTTGGGGGAT
GGGTACTGCGCGTGCCTGACCACTGTCAGTACTTTTGCGGCCGAAATGCGAGATCTGAAGTGGTGGAAGGCGGTT
CGGTATTGTATCATCAGTTGGGGGGCGGGGCAGCTGCTGCTGGTGCTCATTGTGGGGTCTTCGATGTGGGCGGGA
GGAGTGGCCAAAGAGGCGACTTGTAGTTACCATGGGTCTCTCCTCGACAACGACGAGAGATTGATTGCGCGACAA
ATGGCTTCACGACAGTCCATGCCGCCGGACATCGTCCAGCAACCAATGGATGGCGAGCAAGTTGGCGTCCCTGGT
GAGGGCGATGAGATCATGGAGGAACCCGAGGAGCAGGAGGATGGTTACTCATCATCCACGCCAACATCAACGCTC
ACCTGGATCTGCTGGTTTTGTTCTTTGCCTGGCCACGAGTACTTCTGCGAAGTCACTGAGGACTTTATCGAGGAT
GACTTCAATCTGACTGGTCTCAACAACATGGTGCCCTTCTGGAAAGAGGCTATGGAAATGGTGTTAGACGTTGAA
CCAGATGAAGACAACTCAAAAATTCCAGATGTCTCCATTGTAGAGTCATCTGCAGAAATGCTGTATGGCCTAGTA
CACCAACGGTTTATCCTCACTCGGGCTGGCCTTCAGGCGATGCTCGACAAATACGATAACAACACTTTTGGCGTT
TGTCCGCGTGTTTATTGCATGGGTACGAGCGTTGTGCCATGCGGTCGCTCAGATATTCCAGGACTCGATACTGTC
AAGTTGTATTGTCCGAACTGCAACGACCTCTATGTTCCGCCCAGTAGTCGCTTTCAGGGAGTAGATGGAGCGTTT
TTTGGAACTACATTTCCTCACTTATTTTTCCAAACTTATCGAGAGCTTGCGCCCGCGCCATTTTGGCGACCTCCG
CAGGTGGGGGAAGCCCAACCTTCTCCGCGAAGCTCACAGGGAAGTAATCCGCGAACGTCTCCCTTTGTGAACCCA
AACGTGAATGGTGGCCAGAAACGGGCAGCTGGATATGTGTATGTACCACGAATCTACGGATTCAAAGTGAGCGAG
AGGGCAAAGAGCGGACCGAGGATGCAGTGGTTGCGTTTGAGGCCCGAGGATCCAGAGGACTTGGATGCGGTCGAT
TGGAGGGGGAGATGGATTGACGATGAGGATGATGGATACGATGATGACCTGGAGGATGTAGTGGACAGGCCAATG
GAAGATTTTGATCCGGATGCAATGGACGGAGACGAAGAAGAGGAGGAAGAGGAAGAAGAGGAGGAGGAAGCGAGT
AGCACTCGAGATCAAGGACAGCAGAGGAGCTTGGTGTCGCTTTCGCCGGCAGCGAGCTCGGCGCGGACCTCGCCT
AGTTCGCTTGGTGTGCCGTACACGCCCCAGGAGAAGAGTCCTATTTCACCCGGAATGTACACGACGTCGCCTGTG
TATTCTAACGCGAGTCGTGAGAAAGCTGTGTCAGCAGCTATGCAGCACACCAGCCACCCAGGGCCTGTCTCTCTG
CGCTATCTACGACCTCCTCAAGATCTCAAGAAAAATGGCTCGAAGCAATCTCCGTTCAGGACTCAACAAGGGCCG
CCCAACGACCGCCATCGCGCAGTCTGCCAAACCCAGCCACCGCAAGGGTGTGCAATCAACCAAAACCAAATTTGT
GCGGTCTGTTATTCGGGAGGTGGCTGGATTCTCGCCGTACGAGCGTCGTGTGCTGGAGTTACTGAGAAACTCAAA
GGACAAGAAAGCCAGGAAGCTGACCAAGAAGAGGCTCGGAGAGCAGGAGGGCGCACTAGAGCGGGGGAGGGCTGG
CTGGATAGTGATAGTGCTGTGTTGTCGACAGCTGCTGCGTATATGTTGTGCTCTGTAGATAGCTCCGGGAGAATC
GAAGCGAAAATGGAAGCGATGGCCGAGAGCAGAGTGATGAGTCAGACTGCTTACGGAAGCGCGCGAGTGTGCCGA
TCTGGCACTGGATCTCCTTTCTTTTATTCTCTGATGCTTGCGTCTGCGCCCCGGCCTGTCTCATCCTCCCTCAGC
CCCCACCACTCCCTTGGCCGTCGTCGCTCGTCCTCGTCCCTCCTCGACGCCGCCAGCGACCAGCAGCCTCTGTCC
ACAGCGGTCTCTCACCACCAGCCCACCCAGTCAATGATCGTCGTCGTGGTCTCCCGCATCCTCCAGTGGCTGCAC
CTCCAGCCCCAGCACTCCCTCTCCTGGCCCAGCCCCTCTTCTCCTCGGTCAAGCACGGAGAAGCTCGTCCTTCCA
CTCTCGGCCTCCTCCCAAAAAACATCCTTCACTGATGTCCCCTCCGAAGAGTCACGCACGCATCATTTTCCCTCT
GTGCATGCCCCTATCGTTTTCGTCATATGTCTCTTGCCTATATCTACTGCTCTCGTGTTTTACTGCACCTCAACC
CTGCCAATTACTCTCGCGTGGCCTAGAACACTAGAGGACGTCGCTCAGTTAGGACGTGAACTCACGGCTTATACT
CAGTCTGGCACTTGGCCCTTGCTTCACGTCATGGGTGTAATGGCCATTACTGCCATCTGGAAGCACGCCTGGTCT
ATTCCGGGAAGCGTCATCTGGAACGTGTTGGCCGGGGCACTGTTCTCTCCTATCATTGCGACCCTTTTCCTCACG
ACGCTGACTACTATTGGATCCATTTGTGCCACTCTCCTCGCCACACCTCTTGCTCCATTCCTGACGTATCTTTTC
CCCCGAGCCCTCGACATGACTCGTACGGCACTCCATGGCGAATCTGACAACCCGCAGGACGATTCGACAACGGAA
GTGCACAAAAGCAAATCGTCTGCATGGGTCCGGTTGTCAGTCTTGCGGTTGGTTGGGGTTGTACCGTGGTCAGGC
ATCAATATCGCGTGCGGAGTGTGCGGGGTTTCACTCGGTGATTGTGTCATGGGCGCTTTCATCGGATGCCTTCCT
TGGACTGCTGTCACGTGCCAGATTGGTGACATCCTGCAAACGGTTGTGTCCACATCCTCCAACTCGACGCCCGAG
TCGATCTCTTCCATTCTCATGTCACCCCGCATCATCATCAAACTCGCCCTTTTGTCTTTCCTCTCCCTCGCCCCC
ATCCTTGCTCGCAACCGCCTGCGGAAAATGATTCACCCATCTGTCTTCCAGTCGTCACCGGAAAACGAACAATCG
TCCCGGAGAAACTGGGTCCGAGATTTGCGTACGAAGATCTCGAAGACGCGGTCACGCGACCGCAAGCCTTCTTTG
AAATTGAATATCCTTGTTCAAGAAAAGCGTGCAATCGAGGAATTACCCTCGTAA
Transcript >Agabi119p4|623250
ATGTCCCCAGAAGGGGACATTCCGTTACGCGCGACGCCGAACGATGAAGAACGAGGTTCATCTGGATGCGACGCA
GCTTCGACAACAGAATCTGCTGAACGCATTGAACAACCCCCAGCAGAAGAGGAAGGTATTAAGCTGCAATACAAA
ATCTATCCCCCACTTTCTTTTGCCGTTATCGCCCTTCTTGCACCGGCATCCATTCTTGGCACTCTCGCCCGTCTG
GGCCTCTTGGCCATGACAGAATATAATGGCCAATCGATATTCTCTCTGGCCTATGTTCAGGCTCTCGGGTGCCTT
ATCATGGGATTTGCTTTGAGATTGAGGGAGCCTATAGGCCAATTTTATGGCCCATTTTACACTGCATTGACAACA
GGTTTTTGCGGGTCTTTAACTACATTTTCAAGCTGGCAAACTGATATTTTCGATTCCTGGATAAATAATGAAAAT
AATCGTAGAAGCGGATTCCACAGTTTTATTGACGGCCTTGGAAAGTCGGTATTTACCCTTTCATTCTCTTTGGCG
TCCGTTTCTTTCGGATATAATATGGCGAATTTGATTGCTCCATATTTGCCTACTTTCAAATTTCCAAGGAAGGCA
GTGCGATATTCATGGACTGTACTCGCGGTCTGCATGTATGCGGCCGTCTTCCCTGCATATTTTCAAACGTCGGAG
CGGATCCGATGTGCAGCAACTGCGGCACTCCTGTTTGCGTTCCCAGGCGCCCTGACTCGATATCTCCTTGGAATA
TGGCTCAATCAGCGCAGTAGAGCATTGCCTCTAGGAACATTGTTCGCGAATCTGTTCGGGACGGCACTGCTAGGA
GGATTACACGTTCTGCAGGGTTTGCCGAATGCTGTATCGCCCAACGCGTGCTGTATATTACAAGGTTTGGGGGAT
GGGTACTGCGCGTGCCTGACCACTGTCAGTACTTTTGCGGCCGAAATGCGAGATCTGAAGTGGTGGAAGGCGGTT
CGGTATTGTATCATCAGTTGGGGGGCGGGGCAGCTGCTGCTGGTGCTCATTGTGGGGTCTTCGATGTGGGCGGGA
GGAGTGGCCAAAGAGGCGACTTGTAGTTACCATGGGTCTCTCCTCGACAACGACGAGAGATTGATTGCGCGACAA
ATGGCTTCACGACAGTCCATGCCGCCGGACATCGTCCAGCAACCAATGGATGGCGAGCAAGTTGGCGTCCCTGGT
GAGGGCGATGAGATCATGGAGGAACCCGAGGAGCAGGAGGATGGTTACTCATCATCCACGCCAACATCAACGCTC
ACCTGGATCTGCTGGTTTTGTTCTTTGCCTGGCCACGAGTACTTCTGCGAAGTCACTGAGGACTTTATCGAGGAT
GACTTCAATCTGACTGGTCTCAACAACATGGTGCCCTTCTGGAAAGAGGCTATGGAAATGGTGTTAGACGTTGAA
CCAGATGAAGACAACTCAAAAATTCCAGATGTCTCCATTGTAGAGTCATCTGCAGAAATGCTGTATGGCCTAGTA
CACCAACGGTTTATCCTCACTCGGGCTGGCCTTCAGGCGATGCTCGACAAATACGATAACAACACTTTTGGCGTT
TGTCCGCGTGTTTATTGCATGGGTACGAGCGTTGTGCCATGCGGTCGCTCAGATATTCCAGGACTCGATACTGTC
AAGTTGTATTGTCCGAACTGCAACGACCTCTATGTTCCGCCCAGTAGTCGCTTTCAGGGAGTAGATGGAGCGTTT
TTTGGAACTACATTTCCTCACTTATTTTTCCAAACTTATCGAGAGCTTGCGCCCGCGCCATTTTGGCGACCTCCG
CAGGTGGGGGAAGCCCAACCTTCTCCGCGAAGCTCACAGGGAAGTAATCCGCGAACGTCTCCCTTTGTGAACCCA
AACGTGAATGGTGGCCAGAAACGGGCAGCTGGATATGTGTATGTACCACGAATCTACGGATTCAAAGTGAGCGAG
AGGGCAAAGAGCGGACCGAGGATGCAGTGGTTGCGTTTGAGGCCCGAGGATCCAGAGGACTTGGATGCGGTCGAT
TGGAGGGGGAGATGGATTGACGATGAGGATGATGGATACGATGATGACCTGGAGGATGTAGTGGACAGGCCAATG
GAAGATTTTGATCCGGATGCAATGGACGGAGACGAAGAAGAGGAGGAAGAGGAAGAAGAGGAGGAGGAAGCGAGT
AGCACTCGAGATCAAGGACAGCAGAGGAGCTTGGTGTCGCTTTCGCCGGCAGCGAGCTCGGCGCGGACCTCGCCT
AGTTCGCTTGGTGTGCCGTACACGCCCCAGGAGAAGAGTCCTATTTCACCCGGAATGTACACGACGTCGCCTGTG
TATTCTAACGCGAGTCGTGAGAAAGCTGTGTCAGCAGCTATGCAGCACACCAGCCACCCAGGGCCTGTCTCTCTG
CGCTATCTACGACCTCCTCAAGATCTCAAGAAAAATGGCTCGAAGCAATCTCCGTTCAGGACTCAACAAGGGCCG
CCCAACGACCGCCATCGCGCAGTCTGCCAAACCCAGCCACCGCAAGGGTGTGCAATCAACCAAAACCAAATTTGT
GCGGTCTGTTATTCGGGAGGTGGCTGGATTCTCGCCGTACGAGCGTCGTGTGCTGGAGTTACTGAGAAACTCAAA
GGACAAGAAAGCCAGGAAGCTGACCAAGAAGAGGCTCGGAGAGCAGGAGGGCGCACTAGAGCGGGGGAGGGCTGG
CTGGATAGTGATAGTGCTGTGTTGTCGACAGCTGCTGCGTATATGTTGTGCTCTGTAGATAGCTCCGGGAGAATC
GAAGCGAAAATGGAAGCGATGGCCGAGAGCAGAGTGATGAGTCAGACTGCTTACGGAAGCGCGCGAGTGTGCCGA
TCTGGCACTGGATCTCCTTTCTTTTATTCTCTGATGCTTGCGTCTGCGCCCCGGCCTGTCTCATCCTCCCTCAGC
CCCCACCACTCCCTTGGCCGTCGTCGCTCGTCCTCGTCCCTCCTCGACGCCGCCAGCGACCAGCAGCCTCTGTCC
ACAGCGGTCTCTCACCACCAGCCCACCCAGTCAATGATCGTCGTCGTGGTCTCCCGCATCCTCCAGTGGCTGCAC
CTCCAGCCCCAGCACTCCCTCTCCTGGCCCAGCCCCTCTTCTCCTCGGTCAAGCACGGAGAAGCTCGTCCTTCCA
CTCTCGGCCTCCTCCCAAAAAACATCCTTCACTGATGTCCCCTCCGAAGAGTCACGCACGCATCATTTTCCCTCT
GTGCATGCCCCTATCGTTTTCGTCATATGTCTCTTGCCTATATCTACTGCTCTCGTGTTTTACTGCACCTCAACC
CTGCCAATTACTCTCGCGTGGCCTAGAACACTAGAGGACGTCGCTCAGTTAGGACGTGAACTCACGGCTTATACT
CAGTCTGGCACTTGGCCCTTGCTTCACGTCATGGGTGTAATGGCCATTACTGCCATCTGGAAGCACGCCTGGTCT
ATTCCGGGAAGCGTCATCTGGAACGTGTTGGCCGGGGCACTGTTCTCTCCTATCATTGCGACCCTTTTCCTCACG
ACGCTGACTACTATTGGATCCATTTGTGCCACTCTCCTCGCCACACCTCTTGCTCCATTCCTGACGTATCTTTTC
CCCCGAGCCCTCGACATGACTCGTACGGCACTCCATGGCGAATCTGACAACCCGCAGGACGATTCGACAACGGAA
GTGCACAAAAGCAAATCGTCTGCATGGGTCCGGTTGTCAGTCTTGCGGTTGGTTGGGGTTGTACCGTGGTCAGGC
ATCAATATCGCGTGCGGAGTGTGCGGGGTTTCACTCGGTGATTGTGTCATGGGCGCTTTCATCGGATGCCTTCCT
TGGACTGCTGTCACGTGCCAGATTGGTGACATCCTGCAAACGGTTGTGTCCACATCCTCCAACTCGACGCCCGAG
TCGATCTCTTCCATTCTCATGTCACCCCGCATCATCATCAAACTCGCCCTTTTGTCTTTCCTCTCCCTCGCCCCC
ATCCTTGCTCGCAACCGCCTGCGGAAAATGATTCACCCATCTGTCTTCCAGTCGTCACCGGAAAACGAACAATCG
TCCCGGAGAAACTGGGTCCGAGATTTGCGTACGAAGATCTCGAAGACGCGGTCACGCGACCGCAAGCCTTCTTTG
AAATTGAATATCCTTGTTCAAGAAAAGCGTGCAATCGAGGAATTACCCTCGTAA
Gene >Agabi119p4|623250
ATGTCCCCAGAAGGGGACATTCCGTTACGCGCGACGCCGAACGATGAAGAACGAGGTTCATCTGGATGCGACGCA
GCTTCGACAACAGAATCTGCTGAACGCATTGAACAACCCCCAGCAGAAGAGGAAGGTATTAAGCTGCAATACAAA
ATCTATCCCCCACTTTCTTTTGCCGTTATCGCCCTTCTTGCACCGGCATCCATTCTTGGCACTCTCGCCCGTCTG
GGCCTCTTGGCCATGACAGAATATAATGGCCAATCGATATTCTCTCTGGCCTATGTTCAGGCTCTCGGGTGCCTT
ATCATGGGATTTGCTTTGAGATTGAGGGAGCCTATAGGCCAATTGTGAGTCATTTTTATACTGAGTCTTTCAGAT
GACTAGAGATTCGAGTAGTTATGGCCCATTTTACACTGCATTGACAACAGGTATGGTTATATCAAGTGAAAACAT
GAAGCCAACATCTGAGGCCAGAATTCAGGTTTTTGCGGGTCTTTAACTACATTTTCAAGCTGGCAAACTGATATT
TTCGATTCCTGGATAAATAATGAAAATAATCGTAGAAGCGGATTCCACAGTGTGCGCCCTTTTTCTATCCTGATG
TGCGAGAAGATCTTTGACTATCGGCAGTTTATTGACGGCCTTGGAAAGTCGGTATTTACCCTTTCATTCTCTTTG
GCGTCCGTTTCTTTCGGATATAATATGGCGAATTTGATTGCTCCATATTTGCCTACTTTCAAATTTCCAAGGAAG
GCAGTGCGATATTCATGGACTGTACTCGCGGTCTGCATGTATGCGGCCGTCTTCCCTGCATATTTTCAAACGTCG
GAGCGGATCCGATGTGCAGCAACTGCGGCACTCCTGTTTGCGTTCCCAGGCGCCCTGACTCGATATCTCCTTGGA
ATATGGCTCAATCAGCGCAGTAGAGCATTGCCTCTAGGAACATTGTTCGCGAATCTGTTCGGGACGGCACTGCTA
GGAGGATTACACGTTCTGCAGGGTTTGCCGAATGCTGTATCGCCCAACGCGTGCTGTATATTACAAGGTTTGGGG
GATGGGTACTGCGCGTGCCTGACCACTGTCAGTACTTTTGCGGCCGAAATGCGAGATCTGAAGTGGTGGAAGGCG
GTTCGGTATTGTATCATCAGTTGGGGGGCGGGGCAGCTGCTGCTGGTGCTCATTGTGGGGTCTTCGATGTGGGCG
GGAGGAGTGGCCAAAGAGGCGACTTGTAGTTACCATGGGTCGTAAGTATTGTAGAGCCAAGACCGAGTGACGATC
GGAGTTAGAATAGGTCAAAATACATTCTGCGAGTCTCCTCGACAACGACGAGAGATTGATTGCGCGACAAATGGC
TTCACGACAGTCCATGCCGCCGGACATCGTCCAGCAACCAATGGATGGCGAGCAAGTTGGCGTCCCTGGTGAGGG
CGATGAGATCATGGAGGAACCCGAGGAGCAGGAGGATGGTTACTGTGCGTCAATCTTTCATATTGCCTGATCCAT
CGCCTTGCCTCATTGCAAACGGCCCTTCCCTGTTGACCATCGCGTTCGACGATGACCGGCTCTTCAGCATCATCC
ACGCCAACATCAACGCTCACCTGGATCTGCTGGTTTTGTTCTTTGCCTGGCCACGAGTACTTCTGCGAAGTCACT
GAGGACTTTATCGAGGATGACTTCAATCTGACTGGTCTCAACAACATGGTGCCCTTCTGGAAAGAGGCTATGGAA
ATGGTGTTAGACGTTGAACCAGGTGTGGGTTCTTTATCTGCGTCTTCCTCTATTCCAGTACCCTTTCAAGCGTAA
TGACCTCCCCACGGCTCTTTCAGATGAAGACAACTCAAAAATTCCAGATGTCTCCATTGTAGAGTCATCTGCAGA
AATGCTGTATGGCCTAGTACACCAACGGTTTATCCTCACTCGGGCTGGCCTTCAGGCGATGGCAAGTTGACCTCG
ATGGAATTTTTGCTGCTTAGTTTGCTCATGATTCACGCAGCTCGACAAATACGATAACAACACTTTTGGCGTTTG
TCCGCGTGTTTATTGCATGGGTACGAGCGTTGTGCCATGCGGTCGCTCAGATATTCCAGGACTCGATACTGTCAA
GTTGTATTGTCCGAACTGCAACGACCTCTATGTTCCGCCCAGTAGTCGCTTTCAGGGAGTAGATGGTACGTTAAG
CCACCTCTTAAGCAATGACAAAGTCTCCATCTCTATTTTCAGGAGCGTTTTTTGGAACTACATTTCCTCACTTAT
TTTTCCAAACTTATCGAGAGCTTGCGCCCGCGCCATTTTGGCGACCTCCGCAGGTGGGGGAAGCCCAACCTTCTC
CGCGAAGCTCACAGGGAAGTAATCCGCGAACGTCTCCCTTTGTGAACCCAAACGTGAATGGTGGCCAGAAACGGG
CAGCTGGATATGTGTATGTACCACGAATCTACGGATTCAAAGTGAGCGAGAGGGCAAAGAGCGGACCGAGGATGC
AGTGGTTGCGTTTGAGGCCCGAGGATCCAGAGGACTTGGATGCGGTCGATTGGAGGGGGAGATGGATTGACGATG
AGGATGATGGATACGATGATGACCTGGAGGATGTAGTGGACAGGCCAATGGAAGATTTTGATCCGGTATGTACCT
GAAACTAGTTTAGGGGTGTTGCTGCTCAGATGTGCTCCGCTTAGGATGCAATGGACGGAGACGAAGAAGAGGAGG
AAGAGGAAGAAGAGGAGGAGGAAGCGAGTAGCACTCGAGATCAAGGACAGCAGAGGAGCTTGGTGTCGCTTTCGC
CGGCAGCGAGCTCGGCGCGGACCTCGCCTAGTTCGCTTGGTGTGCCGTACACGCCCCAGGAGAAGAGTCCTATTT
CACCCGGAATGTACACGACGTCGCCTGTGTATTCTAACGGTGGCGGCGGCGGGCTGCGCGTCGTCCGGCAGTGGG
TTGCAAGGCCCGAAGTCTGGGCAGGGCCGACTCATTGATACAAAATCTTCTACATATTATTTTTCCCCTTTCTTG
TCATGATGCGGTATAATAGATCTGCTTAGCGAGTCGTGAGAAAGCTGTGTCAGCAGCTATGCAGCACACCAGCCA
CCCAGGGCCTGTCTCTCTGCGCTATCTACGACCTCCTCAAGATCTCAAGAAAAATGGCTCGAAGCAGTGGGTGTT
TCTTTGCTGGTGATATACACAGGAATACTGACGGTTGGGTTGCGACTCATCCCTTGCTCACCTTGCTCAGATCTC
CGTTCAGGACTCAACAAGGGCCGCCCAACGACCGCCATCGCGCAGTCTGCCAAACCCAGCCACCGCAAGGGTGTG
CAATCAACCAAAACCAAATTTGTGCGGTCTGTTATTCGGGAGGTGGCTGGATTCTCGCCGTACGAGCGTCGTGTG
CTGGAGTTACTGAGAAACTCAAAGGTGCTTACTGTTTTTGAGCGTGGGAATTCGGGATGACTGATGTGTTATTTG
ATCAGGACAAGAAAGCCAGGAAGCTGACCAAGAAGAGGGTACGTGATGAGCACGGGTAATAGTCGTGCTACCGAT
AACTGATGGTGATGGTACACAGCTCGGTACTCTTCTCCGTTCGAAACACAAGCTAGAGGAGCTCAGCAATGTGAT
CCAGGAGAGCAGGAGGGCGCACTAGAGCGGGGGAGGGCTGGCTGGATAGTGATAGTGCTGTGTTGTCGACAGCTG
CTGCGTATATGTTGTGCTCTGTAGATAGCTCCGGGAGAATCGAAGCGAAAATGGAAGCGATGGCCGAGAGCAGAG
TGATGAGTCAGACTGCTTACGGAAGCGCGCGAGTGTGCCGATCTGGCACTGGATCTCCTTTCTTTTATTCTCTGA
TGCTTGCGTCTGCGCCCCGGCCTGTCTCATCCTCCCTCAGCCCCCACCACTCCCTTGGCCGTCGTCGCTCGTCCT
CGTCCCTCCTCGACGCCGCCAGCGACCAGCAGCCTCTGTCCACAGCGGTCTCTCACCACCAGCCCACCCAGTCAA
TGATCGTCGTCGTGGTCTCCCGCATCCTCCAGTGGCTGCACCTCCAGCCCCAGCACTCCCTCTCCTGGCCCAGCC
CCTCTTCTCCTCGGTCAAGCACGGAGAAGCTCGTCCTTCCACTCTCGGCCTCCTCCCAAAAAACATCCTTCACTG
ATGTCCCCTCCGAAGAGTCACGCACGCATCATTTTCCCTCTGTAAGTGTGCACCCCCCACTTTGTTTAGCTTTTA
CTGATTCTGTCTCAGGTGCATGCCCCTATCGTTTTCGTCATATGTCTCTTGCCTATATCTACTGCTCTCGTGTTT
TACTGCACCTCAACCCTGCCAATTACTCTCGCGTGGCCTAGAACACTAGAGGACGTCGCTCAGTTAGGACGTGAA
CTCACGGCTTATACTCAGTCTGGCACTTGGCCCTTGCTTCACGTCATGGGTGTAATGGCCATTACTGCCATCTGG
AAGCACGCCTGGTCTATTCCGGGAAGCGTCATCTGGGTATGTATCCTGTCTCTTACGACTTTATTTATTTTCGTG
CTAAACGCATTCCTTCATTCCAGAACGTGTTGGCCGGGGCACTGTTCTCTCCTATCATTGCGACCCTTTTCCTCA
CGACGCTGACTACTATTGGATCCATTTGTGCCACTCTCCTCGCCACACCTCTTGCTCCATTCCTGACGTATCTTT
TCCCCCGAGCCCTCGACATGACTCGTACGGCACTCCATGGCGAATCTGACAACCCGCAGGACGATTCGACAACGG
AAGTGCACAAAAGCAAATCGTCTGCATGGGTCCGGTTGTCAGTCTTGCGGTTGGTTGGGGTTGTACCGTGGTCAG
GCATCAATATCGCGTGCGGAGTGTGCGGGGTTTCACTCGGTGATTGTGTCATGGGCGCTTTCATCGGATGCCTTC
CTTGGACTGCTGTCACGTGCCAGGTAAGTTTCTAGCACAAGACCAGAGTTGCCATTTCTAACTTGCGATCCAGAT
TGGTGACATCCTGCAAACGGTTGTGTCCACATCCTCCAACTCGACGCCCGAGTCGATCTCTTCCATTCTCATGTC
ACCCCGCATCATCATCAAACTCGCCCTTTTGTCTTTCCTCTCCCTCGCCCCCATCCTTGCTCGCAACCGCCTGCG
GAAAATGATTCACCCATCTGTCTTCCAGTCGTCACCGGAAAACGAACAATCGTCCCGGAGAAACTGGGTCCGAGA
TTTGCGTACGAAGATCTCGAAGACGCGGTCACGCGACCGCAAGCCTTCTTTGAAATTGAATATCCTTGTTCAAGA
AAAGCGTGCAATCGAGGAATTACCCTCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail