Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|622900
Gene name
Locationscaffold_04:1098168..1100302
Strand+
Gene length (bp)2134
Transcript length (bp)1719
Coding sequence length (bp)1719
Protein length (aa) 573

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger) 1.7E-11 273 310
PF02190 LON_substr_bdg ATP-dependent protease La (LON) substrate-binding domain 2.2E-10 374 557
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 3.7E-06 273 310
PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger) 7.9E-08 270 314
PF13445 zf-RING_UBOX RING-type zinc-finger 1.5E-05 273 308
PF13639 zf-RING_2 Ring finger domain 1.3E-06 272 311

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60106|YOXA_SCHPO LON peptidase N-terminal domain and RING finger protein C14F5.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC14F5.10c PE=3 SV=1 223 571 7.0E-20
sp|Q17RB8|LONF1_HUMAN LON peptidase N-terminal domain and RING finger protein 1 OS=Homo sapiens GN=LONRF1 PE=1 SV=2 270 425 1.0E-19
sp|Q8HXH0|LONF3_MACFA LON peptidase N-terminal domain and RING finger protein 3 OS=Macaca fascicularis GN=LONRF3 PE=2 SV=1 62 425 3.0E-19
sp|Q496Y0|LONF3_HUMAN LON peptidase N-terminal domain and RING finger protein 3 OS=Homo sapiens GN=LONRF3 PE=1 SV=1 270 425 4.0E-19
sp|Q9D4H7|LONF3_MOUSE LON peptidase N-terminal domain and RING finger protein 3 OS=Mus musculus GN=Lonrf3 PE=2 SV=1 270 425 5.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60106|YOXA_SCHPO LON peptidase N-terminal domain and RING finger protein C14F5.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC14F5.10c PE=3 SV=1 223 571 7.0E-20
sp|Q17RB8|LONF1_HUMAN LON peptidase N-terminal domain and RING finger protein 1 OS=Homo sapiens GN=LONRF1 PE=1 SV=2 270 425 1.0E-19
sp|Q8HXH0|LONF3_MACFA LON peptidase N-terminal domain and RING finger protein 3 OS=Macaca fascicularis GN=LONRF3 PE=2 SV=1 62 425 3.0E-19
sp|Q496Y0|LONF3_HUMAN LON peptidase N-terminal domain and RING finger protein 3 OS=Homo sapiens GN=LONRF3 PE=1 SV=1 270 425 4.0E-19
sp|Q9D4H7|LONF3_MOUSE LON peptidase N-terminal domain and RING finger protein 3 OS=Mus musculus GN=Lonrf3 PE=2 SV=1 270 425 5.0E-19
sp|Q1L5Z9|LONF2_HUMAN LON peptidase N-terminal domain and RING finger protein 2 OS=Homo sapiens GN=LONRF2 PE=2 SV=3 268 567 2.0E-16
sp|Q0IIM1|RN168_BOVIN E3 ubiquitin-protein ligase RNF168 OS=Bos taurus GN=RNF168 PE=2 SV=2 268 358 9.0E-08
sp|F6UA42|UHRF1_XENTR E3 ubiquitin-protein ligase UHRF1 OS=Xenopus tropicalis GN=uhrf1 PE=3 SV=2 160 344 7.0E-07
sp|E7EZF3|UHRF1_DANRE E3 ubiquitin-protein ligase UHRF1 OS=Danio rerio GN=uhrf1 PE=1 SV=1 199 338 1.0E-06
sp|Q9P3U8|YJ95_SCHPO Uncharacterized RING finger protein C548.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC548.05c PE=3 SV=1 246 314 1.0E-06
sp|O76064|RNF8_HUMAN E3 ubiquitin-protein ligase RNF8 OS=Homo sapiens GN=RNF8 PE=1 SV=1 251 344 2.0E-06
sp|Q7TMI3|UHRF2_MOUSE E3 ubiquitin-protein ligase UHRF2 OS=Mus musculus GN=Uhrf2 PE=1 SV=1 257 334 2.0E-06
sp|Q8N448|LNX2_HUMAN Ligand of Numb protein X 2 OS=Homo sapiens GN=LNX2 PE=1 SV=1 255 314 2.0E-06
sp|Q5R4I2|RNF8_PONAB E3 ubiquitin-protein ligase RNF8 OS=Pongo abelii GN=RNF8 PE=2 SV=1 256 344 3.0E-06
sp|Q7T308|RN168_DANRE E3 ubiquitin-protein ligase RNF168 OS=Danio rerio GN=rnf168 PE=2 SV=1 273 334 3.0E-06
sp|Q91XL2|LNX2_MOUSE Ligand of Numb protein X 2 OS=Mus musculus GN=Lnx2 PE=1 SV=2 255 314 3.0E-06
sp|Q9FKA7|ORTH1_ARATH E3 ubiquitin-protein ligase ORTHRUS 1 OS=Arabidopsis thaliana GN=ORTH1 PE=1 SV=1 254 333 5.0E-06
sp|P10862|RAD18_YEAST Postreplication repair E3 ubiquitin-protein ligase RAD18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD18 PE=1 SV=1 263 340 5.0E-06
sp|Q8IYW5|RN168_HUMAN E3 ubiquitin-protein ligase RNF168 OS=Homo sapiens GN=RNF168 PE=1 SV=1 268 345 5.0E-06
sp|Q6FPI4|RAD18_CANGA Postreplication repair E3 ubiquitin-protein ligase RAD18 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RAD18 PE=3 SV=1 271 314 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 59 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|622900
MSSRKRKQDELGDRCGDADHRELSVRPAAADADAPRQDPAADPCRESPGPPPLSPAAVDALFCCAVCHGPLRQPA
TLHCGHSVCAVHVTGPSDQPPPDSPLPPRCPLRSCDSTLVPSPAQPRIPASSRVRYHPVPDAAARPVLVQPETVP
EPRLDVTLSKVLDLVARTKQALLEDATTDSSDGEPDSHSSAHDHSVRRPRKRRRRRISPPPEDDSADDLLSHLRK
QAVHQRTLSHDEPVLPSLPPSQTDTPLPRSKDAVLARFQKDLLVELTCEICFVLLYQPITTPCQHTFCAKCLHRS
LDHSPACPLCRQDLPGFAYFQDHPTNKTLLSIILKTWPMLYRERAQFPRSSHSITLFRTKVPPHAPQMPRIAESP
VWYDYGTKTSVQMLPDGRSMVETWGTFRFRIFERGTLDGYMVGRIERIDDYPEDLDASSFLFPSNSIITSPETPS
SSSSASTPSDPAHPPTPPSLPIPIHPNSPTNEELMTTCRTFLHRLQRGTAPWVVQRLSSTYGTMPTDPSAFSFWV
ALVLPIDEHEKAKLLPLRSARLRLLLLVHWIEQLNSQWWFSSGCTIL*
Coding >Agabi119p4|622900
ATGTCCTCTCGCAAGCGCAAGCAGGACGAGCTTGGAGACCGGTGCGGCGACGCCGACCACCGTGAGCTTTCTGTC
CGTCCCGCTGCCGCTGACGCCGACGCTCCTCGCCAGGATCCTGCCGCAGATCCCTGCCGCGAGTCTCCTGGCCCC
CCGCCGCTTTCACCCGCCGCCGTCGACGCTCTCTTCTGCTGCGCCGTCTGCCACGGCCCCCTCCGCCAGCCGGCC
ACCCTCCACTGCGGTCATTCCGTCTGTGCCGTCCATGTCACTGGACCCAGCGACCAGCCTCCTCCGGACTCACCG
CTCCCTCCCCGGTGTCCTCTCCGCAGCTGCGACTCGACGCTTGTGCCGTCTCCGGCCCAGCCCCGCATCCCCGCA
TCTTCCCGCGTGCGATACCATCCGGTGCCCGATGCTGCCGCCCGTCCAGTCCTCGTCCAGCCGGAAACAGTGCCC
GAGCCGCGTCTGGACGTCACCCTGAGCAAGGTCCTTGACCTGGTCGCTCGCACCAAGCAAGCTCTCCTCGAGGAC
GCGACCACTGATTCTTCCGACGGAGAACCCGATTCACATTCTTCCGCCCATGATCATTCAGTCCGTCGACCCCGC
AAGCGCCGACGGCGTCGTATCAGTCCACCTCCCGAGGACGACAGTGCCGATGATCTCCTCTCCCATCTCAGAAAA
CAGGCAGTTCATCAACGCACCTTGTCCCATGACGAGCCTGTTCTTCCGTCATTACCGCCTTCCCAAACCGATACT
CCCTTGCCCCGTTCGAAAGATGCCGTCCTGGCCCGCTTCCAGAAAGATCTCCTTGTAGAACTCACCTGCGAGATA
TGCTTCGTCCTTCTTTATCAGCCGATTACCACCCCATGTCAACATACCTTTTGTGCGAAATGTCTACACAGATCC
CTGGACCACAGCCCTGCCTGTCCCCTCTGCAGACAAGATCTTCCTGGCTTTGCCTACTTCCAGGATCACCCCACC
AATAAAACCCTCCTGTCCATCATTCTCAAAACTTGGCCAATGCTCTACAGGGAACGTGCTCAGTTTCCCAGGAGC
TCCCACTCTATTACACTTTTTCGAACCAAGGTACCGCCTCATGCTCCGCAGATGCCTAGAATCGCAGAATCCCCG
GTTTGGTATGATTATGGCACCAAAACCAGTGTCCAGATGCTCCCAGACGGCCGTAGCATGGTCGAGACCTGGGGG
ACTTTCCGTTTTCGTATATTCGAACGTGGCACGCTGGATGGGTATATGGTTGGGCGAATAGAAAGAATCGACGAT
TACCCTGAGGATCTTGACGCGTCTTCCTTTCTTTTCCCTTCAAATTCAATCATCACCTCGCCAGAAACTCCCTCC
TCTTCCTCTTCTGCATCAACACCATCCGACCCTGCCCACCCACCTACGCCACCATCACTCCCAATCCCAATTCAT
CCAAACTCGCCCACGAATGAAGAATTGATGACAACGTGTCGAACCTTCCTCCATCGTCTACAACGGGGCACTGCA
CCTTGGGTTGTTCAACGACTCTCAAGCACATACGGCACAATGCCCACCGATCCTTCTGCCTTTTCATTCTGGGTA
GCGCTCGTCCTGCCTATTGATGAACACGAAAAGGCTAAACTGTTACCGCTGAGGAGTGCCCGATTACGATTGTTG
TTATTGGTCCATTGGATTGAACAACTGAATAGTCAATGGTGGTTTTCAAGTGGATGTACCATTCTATGA
Transcript >Agabi119p4|622900
ATGTCCTCTCGCAAGCGCAAGCAGGACGAGCTTGGAGACCGGTGCGGCGACGCCGACCACCGTGAGCTTTCTGTC
CGTCCCGCTGCCGCTGACGCCGACGCTCCTCGCCAGGATCCTGCCGCAGATCCCTGCCGCGAGTCTCCTGGCCCC
CCGCCGCTTTCACCCGCCGCCGTCGACGCTCTCTTCTGCTGCGCCGTCTGCCACGGCCCCCTCCGCCAGCCGGCC
ACCCTCCACTGCGGTCATTCCGTCTGTGCCGTCCATGTCACTGGACCCAGCGACCAGCCTCCTCCGGACTCACCG
CTCCCTCCCCGGTGTCCTCTCCGCAGCTGCGACTCGACGCTTGTGCCGTCTCCGGCCCAGCCCCGCATCCCCGCA
TCTTCCCGCGTGCGATACCATCCGGTGCCCGATGCTGCCGCCCGTCCAGTCCTCGTCCAGCCGGAAACAGTGCCC
GAGCCGCGTCTGGACGTCACCCTGAGCAAGGTCCTTGACCTGGTCGCTCGCACCAAGCAAGCTCTCCTCGAGGAC
GCGACCACTGATTCTTCCGACGGAGAACCCGATTCACATTCTTCCGCCCATGATCATTCAGTCCGTCGACCCCGC
AAGCGCCGACGGCGTCGTATCAGTCCACCTCCCGAGGACGACAGTGCCGATGATCTCCTCTCCCATCTCAGAAAA
CAGGCAGTTCATCAACGCACCTTGTCCCATGACGAGCCTGTTCTTCCGTCATTACCGCCTTCCCAAACCGATACT
CCCTTGCCCCGTTCGAAAGATGCCGTCCTGGCCCGCTTCCAGAAAGATCTCCTTGTAGAACTCACCTGCGAGATA
TGCTTCGTCCTTCTTTATCAGCCGATTACCACCCCATGTCAACATACCTTTTGTGCGAAATGTCTACACAGATCC
CTGGACCACAGCCCTGCCTGTCCCCTCTGCAGACAAGATCTTCCTGGCTTTGCCTACTTCCAGGATCACCCCACC
AATAAAACCCTCCTGTCCATCATTCTCAAAACTTGGCCAATGCTCTACAGGGAACGTGCTCAGTTTCCCAGGAGC
TCCCACTCTATTACACTTTTTCGAACCAAGGTACCGCCTCATGCTCCGCAGATGCCTAGAATCGCAGAATCCCCG
GTTTGGTATGATTATGGCACCAAAACCAGTGTCCAGATGCTCCCAGACGGCCGTAGCATGGTCGAGACCTGGGGG
ACTTTCCGTTTTCGTATATTCGAACGTGGCACGCTGGATGGGTATATGGTTGGGCGAATAGAAAGAATCGACGAT
TACCCTGAGGATCTTGACGCGTCTTCCTTTCTTTTCCCTTCAAATTCAATCATCACCTCGCCAGAAACTCCCTCC
TCTTCCTCTTCTGCATCAACACCATCCGACCCTGCCCACCCACCTACGCCACCATCACTCCCAATCCCAATTCAT
CCAAACTCGCCCACGAATGAAGAATTGATGACAACGTGTCGAACCTTCCTCCATCGTCTACAACGGGGCACTGCA
CCTTGGGTTGTTCAACGACTCTCAAGCACATACGGCACAATGCCCACCGATCCTTCTGCCTTTTCATTCTGGGTA
GCGCTCGTCCTGCCTATTGATGAACACGAAAAGGCTAAACTGTTACCGCTGAGGAGTGCCCGATTACGATTGTTG
TTATTGGTCCATTGGATTGAACAACTGAATAGTCAATGGTGGTTTTCAAGTGGATGTACCATTCTATGA
Gene >Agabi119p4|622900
ATGTCCTCTCGCAAGCGCAAGCAGGACGAGCTTGGAGACCGGTGCGGCGACGCCGACCACCGTGAGCTTTCTGTC
CGTCCCGCTGCCGCTGACGCCGACGCTCCTCGCCAGGATCCTGCCGCAGATCCCTGCCGCGAGTCTCCTGGCCCC
CCGCCGCTTTCACCCGCCGCCGTCGACGCTCTCTTCTGCTGCGCCGTCTGCCACGGCCCCCTCCGCCAGCCGGCC
ACCCTCCACTGCGGTCATTCCGTCTGTGCCGTCCATGTCACTGGACCCAGCGACCAGCCTCCTCCGGACTCACCG
CTCCCTCCCCGGTGTCCTCTCCGCAGCTGCGACTCGACGCTTGTGCCGTCTCCGGCCCAGCCCCGCATCCCCGCA
TCTTCCCGCGTGCGATACCATCCGGTGCCCGATGCTGCCGCCCGTCCAGTCCTCGTCCAGCCGGAAACAGTGCCC
GAGCCGCGTCTGGACGTCACCCTGAGCAAGGTCCTTGACCTGGTCGCTCGCACCAAGCAAGCTCTCCTCGAGGAC
GCGACCACTGATTCTTCCGACGGAGAACCCGATTCACATTCTTCCGCCCATGATCATTCAGTCCGTCGACCCCGC
AAGCGCCGACGGCGTCGTATCAGTCCACCTCCCGAGGACGACAGTGCCGATGATCTCCTCTCCCATCTCAGAAAA
CAGGCAGTTCATCAACGCACCTTGTCCCATGACGAGCCTGTTCTTCCGTCATTACCGCCTTCCCAAACCGATACT
CCCTTGCCCCGTTCGAAAGATGCCGTCCTGGCCCGCTTCCAGAAAGATCTCCTTGTAGAACTCACCTGCGAGATA
TGCTTCGTCCTTCTTTATCAGCCGATTACCACCCCATGTCAACATGTAAGACCCATCCCCTCACTTATACTCCAG
ATCTAATCCTCCTCCTCCAGACCTTTTGTGCGAAATGTCTACACAGATCCCTGGACCACAGCCCTGCCTGTCCCC
TCTGCAGACAAGATCTTCCTGGCTTTGCCTACTTCCAGGATCACCCCACCAATAAAACCCTCCTGTCCATCAGTC
AGTACTGCCTCACCCCTCCCACCTTGTTTTCTGACCAGGTGTCCCATAGTTCTCAAAACTTGGCCAATGCTCTAC
AGGGAACGTGGTGAGGCCCTGGCTGCCGAAGAACGCGACGCTCGTCTTGATACCCCAATATTCGTCTGTCAGCTC
AGTTTCCCAGGAGCTCCCACTCTATTACACTTTTTCGAACCAAGGTACGCGTCCATTTTCCCCCTCATAAGTCGA
CATTTAACATTTTCTGGTCTCCAAGGTACCGCCTCATGCTCCGCAGATGCCTAGAATCGCAGAATCCCCGGTTTG
GTATGATTATGGCACCAAAACCAGGTGCAGGATCGCCCCAAACCGATTATGGTACCATGCTAGAAATTCGCAGTG
TCCAGATGCTCCCAGACGGCCGTAGCATGGTCGAGACCTGGGGGACTTTCCGTTTTCGTATATTCGAACGTGGCA
CGCTGGATGGGTATATGGTTGGGCGAATAGAAAGGCAAGTTCAATCGGATCGCCATCATGAAATTCAAGTCATTA
ATCACGTAATCTGCAATCAGAATCGACGATTACCCTGAGGATCTTGACGCGTCTTCCTTTCTTTTCCCTTCAAAT
TCAATCATCACCTCGCCAGAAACTCCCTCCTCTTCCTCTTCTGCATCAACACCATCCGACCCTGCCCACCCACCT
ACGCCACCATCACTCCCAATCCCAATTCATCCAAACTCGCCCACGAATGAAGAATTGATGACAACGTGTCGAACC
TTCCTCCATCGTCTACAACGGGGCACTGCACCTTGGGTTGTTCAACGACTCTCAAGCACATACGGCACAATGCCC
ACCGATCCTTCTGCCTTTTCATTCTGGGTAGCGCTCGTCCTGCCTATTGATGAACACGAAAAGGCTAAACTGTTA
CCGCTGAGGAGTGCCCGATTACGATTGTTGTTATTGGTCCATTGGATTGAACAACTGAATAGTCAATGGTACGCC
TTTGTGTGGAAGGTGGTGGCGTGCTGCATGTGGACAGCTTTTGTGCTCACGATTTCGCGTTTGGTTGGTTTTATA
TAGGTGGTTTTCAAGTGGATGTACCATTCTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail