Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|622750
Gene name
Locationscaffold_04:1025436..1027299
Strand-
Gene length (bp)1863
Transcript length (bp)1761
Coding sequence length (bp)1761
Protein length (aa) 587

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00415 RCC1 Regulator of chromosome condensation (RCC1) repeat 1.2E-10 341 394
PF00415 RCC1 Regulator of chromosome condensation (RCC1) repeat 9.7E-10 398 455
PF00415 RCC1 Regulator of chromosome condensation (RCC1) repeat 9.1E-05 459 527
PF00415 RCC1 Regulator of chromosome condensation (RCC1) repeat 2.6E-08 532 580
PF13540 RCC1_2 Regulator of chromosome condensation (RCC1) repeat 6.8E-10 382 410
PF13540 RCC1_2 Regulator of chromosome condensation (RCC1) repeat 3.8E-06 442 466

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P28745|RCC1_SCHPO Protein pim1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pim1 PE=1 SV=2 108 580 3.0E-67
sp|P21827|RCC1_YEAST Guanine nucleotide exchange factor SRM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRM1 PE=1 SV=1 149 580 7.0E-47
sp|P25183|RCC1_XENLA Regulator of chromosome condensation OS=Xenopus laevis GN=rcc1 PE=2 SV=1 108 586 9.0E-45
sp|P18754|RCC1_HUMAN Regulator of chromosome condensation OS=Homo sapiens GN=RCC1 PE=1 SV=1 113 586 1.0E-43
sp|P23800|RCC1_MESAU Regulator of chromosome condensation OS=Mesocricetus auratus GN=RCC1 PE=1 SV=1 116 586 2.0E-43
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P28745|RCC1_SCHPO Protein pim1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pim1 PE=1 SV=2 108 580 3.0E-67
sp|P21827|RCC1_YEAST Guanine nucleotide exchange factor SRM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRM1 PE=1 SV=1 149 580 7.0E-47
sp|P25183|RCC1_XENLA Regulator of chromosome condensation OS=Xenopus laevis GN=rcc1 PE=2 SV=1 108 586 9.0E-45
sp|P18754|RCC1_HUMAN Regulator of chromosome condensation OS=Homo sapiens GN=RCC1 PE=1 SV=1 113 586 1.0E-43
sp|P23800|RCC1_MESAU Regulator of chromosome condensation OS=Mesocricetus auratus GN=RCC1 PE=1 SV=1 116 586 2.0E-43
sp|Q8VE37|RCC1_MOUSE Regulator of chromosome condensation OS=Mus musculus GN=Rcc1 PE=1 SV=1 116 586 1.0E-40
sp|P25171|RCC1_DROME Regulator of chromosome condensation OS=Drosophila melanogaster GN=Rcc1 PE=1 SV=2 149 584 8.0E-38
sp|P52499|RCC1_CANAX Protein RCC1 OS=Candida albicans GN=RCC1 PE=3 SV=1 143 580 1.0E-34
sp|Q15034|HERC3_HUMAN Probable E3 ubiquitin-protein ligase HERC3 OS=Homo sapiens GN=HERC3 PE=1 SV=1 149 556 3.0E-24
sp|Q9FN03|UVR8_ARATH Ultraviolet-B receptor UVR8 OS=Arabidopsis thaliana GN=UVR8 PE=1 SV=1 192 559 2.0E-23
sp|Q6PAV2|HERC4_MOUSE Probable E3 ubiquitin-protein ligase HERC4 OS=Mus musculus GN=Herc4 PE=1 SV=2 149 574 2.0E-22
sp|Q6PAV2|HERC4_MOUSE Probable E3 ubiquitin-protein ligase HERC4 OS=Mus musculus GN=Herc4 PE=1 SV=2 322 585 4.0E-22
sp|Q5PQN1|HERC4_RAT Probable E3 ubiquitin-protein ligase HERC4 OS=Rattus norvegicus GN=Herc4 PE=2 SV=1 322 585 4.0E-22
sp|Q5PQN1|HERC4_RAT Probable E3 ubiquitin-protein ligase HERC4 OS=Rattus norvegicus GN=Herc4 PE=2 SV=1 149 574 5.0E-22
sp|Q3MHW0|SRGEF_BOVIN Secretion-regulating guanine nucleotide exchange factor OS=Bos taurus GN=SERGEF PE=2 SV=1 133 584 2.0E-21
sp|Q18211|RCC1_CAEEL Regulator of chromosome condensation OS=Caenorhabditis elegans GN=ran-3 PE=3 SV=1 15 585 4.0E-21
sp|Q9VR91|HERC2_DROME Probable E3 ubiquitin-protein ligase HERC2 OS=Drosophila melanogaster GN=HERC2 PE=1 SV=3 249 582 1.0E-20
sp|Q8IVU3|HERC6_HUMAN Probable E3 ubiquitin-protein ligase HERC6 OS=Homo sapiens GN=HERC6 PE=2 SV=2 294 583 5.0E-20
sp|Q5GLZ8|HERC4_HUMAN Probable E3 ubiquitin-protein ligase HERC4 OS=Homo sapiens GN=HERC4 PE=1 SV=1 149 574 6.0E-20
sp|Q80YD6|SRGEF_MOUSE Secretion-regulating guanine nucleotide exchange factor OS=Mus musculus GN=Sergef PE=2 SV=2 142 584 9.0E-20
sp|Q9UGK8|SRGEF_HUMAN Secretion-regulating guanine nucleotide exchange factor OS=Homo sapiens GN=SERGEF PE=1 SV=2 156 584 4.0E-19
sp|Q5DX34|RPGRH_CAEEL X-linked retinitis pigmentosa GTPase regulator homolog OS=Caenorhabditis elegans GN=glo-4 PE=1 SV=2 267 581 4.0E-19
sp|Q6PAV2|HERC4_MOUSE Probable E3 ubiquitin-protein ligase HERC4 OS=Mus musculus GN=Herc4 PE=1 SV=2 320 579 5.0E-19
sp|Q92834|RPGR_HUMAN X-linked retinitis pigmentosa GTPase regulator OS=Homo sapiens GN=RPGR PE=1 SV=2 149 474 7.0E-19
sp|Q15034|HERC3_HUMAN Probable E3 ubiquitin-protein ligase HERC3 OS=Homo sapiens GN=HERC3 PE=1 SV=1 324 583 1.0E-18
sp|Q5PQN1|HERC4_RAT Probable E3 ubiquitin-protein ligase HERC4 OS=Rattus norvegicus GN=Herc4 PE=2 SV=1 320 579 2.0E-18
sp|F2Z461|HERC6_MOUSE E3 ISG15--protein ligase Herc6 OS=Mus musculus GN=Herc6 PE=2 SV=1 189 472 4.0E-18
sp|Q5GLZ8|HERC4_HUMAN Probable E3 ubiquitin-protein ligase HERC4 OS=Homo sapiens GN=HERC4 PE=1 SV=1 320 579 6.0E-18
sp|Q9N1T2|RPGR_CANLF X-linked retinitis pigmentosa GTPase regulator OS=Canis lupus familiaris GN=RPGR PE=2 SV=1 265 580 1.0E-17
sp|Q9N1T2|RPGR_CANLF X-linked retinitis pigmentosa GTPase regulator OS=Canis lupus familiaris GN=RPGR PE=2 SV=1 149 482 4.0E-17
sp|Q9R0X5|RPGR_MOUSE X-linked retinitis pigmentosa GTPase regulator OS=Mus musculus GN=Rpgr PE=1 SV=2 149 474 4.0E-17
sp|Q9FN03|UVR8_ARATH Ultraviolet-B receptor UVR8 OS=Arabidopsis thaliana GN=UVR8 PE=1 SV=1 251 586 7.0E-17
sp|Q92834|RPGR_HUMAN X-linked retinitis pigmentosa GTPase regulator OS=Homo sapiens GN=RPGR PE=1 SV=2 265 579 9.0E-17
sp|Q8IVU3|HERC6_HUMAN Probable E3 ubiquitin-protein ligase HERC6 OS=Homo sapiens GN=HERC6 PE=2 SV=2 185 540 1.0E-16
sp|Q7ZZC8|NEK9_XENLA Serine/threonine-protein kinase Nek9 OS=Xenopus laevis GN=nek9 PE=2 SV=1 262 579 1.0E-16
sp|Q6P798|RCBT2_RAT RCC1 and BTB domain-containing protein 2 OS=Rattus norvegicus GN=Rcbtb2 PE=2 SV=1 268 563 3.0E-16
sp|Q99LJ7|RCBT2_MOUSE RCC1 and BTB domain-containing protein 2 OS=Mus musculus GN=Rcbtb2 PE=2 SV=1 268 563 4.0E-16
sp|Q9UII4|HERC5_HUMAN E3 ISG15--protein ligase HERC5 OS=Homo sapiens GN=HERC5 PE=1 SV=2 317 581 6.0E-16
sp|Q5RCZ7|RCBT2_PONAB RCC1 and BTB domain-containing protein 2 OS=Pongo abelii GN=RCBTB2 PE=2 SV=1 268 563 2.0E-15
sp|O95199|RCBT2_HUMAN RCC1 and BTB domain-containing protein 2 OS=Homo sapiens GN=RCBTB2 PE=1 SV=1 268 563 2.0E-15
sp|Q9VR91|HERC2_DROME Probable E3 ubiquitin-protein ligase HERC2 OS=Drosophila melanogaster GN=HERC2 PE=1 SV=3 262 582 8.0E-15
sp|Q6NXM2|RCBT1_MOUSE RCC1 and BTB domain-containing protein 1 OS=Mus musculus GN=Rcbtb1 PE=2 SV=1 277 563 1.0E-14
sp|F2Z461|HERC6_MOUSE E3 ISG15--protein ligase Herc6 OS=Mus musculus GN=Herc6 PE=2 SV=1 324 545 2.0E-14
sp|Q15751|HERC1_HUMAN Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens GN=HERC1 PE=1 SV=2 267 582 2.0E-14
sp|Q8NDN9|RCBT1_HUMAN RCC1 and BTB domain-containing protein 1 OS=Homo sapiens GN=RCBTB1 PE=2 SV=1 263 563 2.0E-14
sp|Q15751|HERC1_HUMAN Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens GN=HERC1 PE=1 SV=2 149 564 4.0E-14
sp|Q9R0X5|RPGR_MOUSE X-linked retinitis pigmentosa GTPase regulator OS=Mus musculus GN=Rpgr PE=1 SV=2 265 580 6.0E-14
sp|Q6NYE2|RCC2_DANRE Protein RCC2 homolog OS=Danio rerio GN=rcc2 PE=2 SV=1 323 582 1.0E-13
sp|Q8TD19|NEK9_HUMAN Serine/threonine-protein kinase Nek9 OS=Homo sapiens GN=NEK9 PE=1 SV=2 267 580 1.0E-13
sp|Q9CYF5|WBS16_MOUSE Williams-Beuren syndrome chromosomal region 16 protein homolog OS=Mus musculus GN=Wbscr16 PE=2 SV=1 284 584 3.0E-13
sp|Q8K1R7|NEK9_MOUSE Serine/threonine-protein kinase Nek9 OS=Mus musculus GN=Nek9 PE=1 SV=2 267 581 4.0E-13
sp|O95714|HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 196 473 4.0E-13
sp|Q4U2R1|HERC2_MOUSE E3 ubiquitin-protein ligase HERC2 OS=Mus musculus GN=Herc2 PE=1 SV=3 196 473 4.0E-13
sp|Q9R0X5|RPGR_MOUSE X-linked retinitis pigmentosa GTPase regulator OS=Mus musculus GN=Rpgr PE=1 SV=2 327 585 1.0E-12
sp|O95714|HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 262 582 1.0E-12
sp|Q4U2R1|HERC2_MOUSE E3 ubiquitin-protein ligase HERC2 OS=Mus musculus GN=Herc2 PE=1 SV=3 262 582 1.0E-12
sp|Q4R828|RCCD1_MACFA RCC1 domain-containing protein 1 OS=Macaca fascicularis GN=RCCD1 PE=2 SV=1 380 579 1.0E-12
sp|Q9FN03|UVR8_ARATH Ultraviolet-B receptor UVR8 OS=Arabidopsis thaliana GN=UVR8 PE=1 SV=1 323 580 3.0E-12
sp|Q8SSY6|SPKUL_DICDI Bifunctional serine/threonine-protein kinase/NEDD4-like E3 ubiquitin-protein ligase OS=Dictyostelium discoideum GN=DDB_G0276527 PE=3 SV=2 379 585 1.0E-11
sp|O95714|HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 205 580 2.0E-11
sp|A6NED2|RCCD1_HUMAN RCC1 domain-containing protein 1 OS=Homo sapiens GN=RCCD1 PE=1 SV=1 380 579 2.0E-11
sp|Q9VR91|HERC2_DROME Probable E3 ubiquitin-protein ligase HERC2 OS=Drosophila melanogaster GN=HERC2 PE=1 SV=3 186 473 3.0E-11
sp|Q6NXM2|RCBT1_MOUSE RCC1 and BTB domain-containing protein 1 OS=Mus musculus GN=Rcbtb1 PE=2 SV=1 251 539 3.0E-11
sp|Q4U2R1|HERC2_MOUSE E3 ubiquitin-protein ligase HERC2 OS=Mus musculus GN=Herc2 PE=1 SV=3 205 580 3.0E-11
sp|Q9VR91|HERC2_DROME Probable E3 ubiquitin-protein ligase HERC2 OS=Drosophila melanogaster GN=HERC2 PE=1 SV=3 149 482 4.0E-11
sp|Q9P258|RCC2_HUMAN Protein RCC2 OS=Homo sapiens GN=RCC2 PE=1 SV=2 211 575 6.0E-11
sp|Q6NYE2|RCC2_DANRE Protein RCC2 homolog OS=Danio rerio GN=rcc2 PE=2 SV=1 211 575 8.0E-11
sp|Q15751|HERC1_HUMAN Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens GN=HERC1 PE=1 SV=2 153 457 1.0E-10
sp|Q8SSY6|SPKUL_DICDI Bifunctional serine/threonine-protein kinase/NEDD4-like E3 ubiquitin-protein ligase OS=Dictyostelium discoideum GN=DDB_G0276527 PE=3 SV=2 323 557 1.0E-10
sp|Q8BK67|RCC2_MOUSE Protein RCC2 OS=Mus musculus GN=Rcc2 PE=1 SV=1 211 575 1.0E-10
sp|Q8BTU7|RCCD1_MOUSE RCC1 domain-containing protein 1 OS=Mus musculus GN=Rccd1 PE=2 SV=2 383 575 4.0E-10
sp|Q9VR91|HERC2_DROME Probable E3 ubiquitin-protein ligase HERC2 OS=Drosophila melanogaster GN=HERC2 PE=1 SV=3 303 571 5.0E-10
sp|Q96I51|WBS16_HUMAN Williams-Beuren syndrome chromosomal region 16 protein OS=Homo sapiens GN=WBSCR16 PE=1 SV=2 284 584 7.0E-10
sp|Q80YD6|SRGEF_MOUSE Secretion-regulating guanine nucleotide exchange factor OS=Mus musculus GN=Sergef PE=2 SV=2 267 586 1.0E-09
sp|F2Z461|HERC6_MOUSE E3 ISG15--protein ligase Herc6 OS=Mus musculus GN=Herc6 PE=2 SV=1 369 582 3.0E-09
sp|O95714|HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 323 582 3.0E-09
sp|Q4U2R1|HERC2_MOUSE E3 ubiquitin-protein ligase HERC2 OS=Mus musculus GN=Herc2 PE=1 SV=3 323 582 3.0E-09
sp|Q90XC2|NEK8_DANRE Serine/threonine-protein kinase Nek8 OS=Danio rerio GN=nek8 PE=2 SV=1 183 489 3.0E-09
sp|Q90XC2|NEK8_DANRE Serine/threonine-protein kinase Nek8 OS=Danio rerio GN=nek8 PE=2 SV=1 324 582 7.0E-09
sp|Q4U2R1|HERC2_MOUSE E3 ubiquitin-protein ligase HERC2 OS=Mus musculus GN=Herc2 PE=1 SV=3 196 456 8.0E-09
sp|O95714|HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 196 456 9.0E-09
sp|Q86SG6|NEK8_HUMAN Serine/threonine-protein kinase Nek8 OS=Homo sapiens GN=NEK8 PE=1 SV=1 183 481 2.0E-08
sp|Q9CYF5|WBS16_MOUSE Williams-Beuren syndrome chromosomal region 16 protein homolog OS=Mus musculus GN=Wbscr16 PE=2 SV=1 322 576 3.0E-08
sp|Q52KW8|RCC2_XENLA Protein RCC2 homolog OS=Xenopus laevis GN=rcc2 PE=2 SV=1 117 471 3.0E-08
sp|O42645|YF94_SCHPO RCC1 repeat-containing protein C10F6.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC10F6.04 PE=3 SV=1 195 461 3.0E-08
sp|Q6NRS1|IBTK_XENLA Inhibitor of Bruton tyrosine kinase OS=Xenopus laevis GN=ibtk PE=2 SV=1 278 478 3.0E-08
sp|Q9UII4|HERC5_HUMAN E3 ISG15--protein ligase HERC5 OS=Homo sapiens GN=HERC5 PE=1 SV=2 195 455 4.0E-08
sp|Q8TD19|NEK9_HUMAN Serine/threonine-protein kinase Nek9 OS=Homo sapiens GN=NEK9 PE=1 SV=2 267 585 4.0E-08
sp|Q52KW8|RCC2_XENLA Protein RCC2 homolog OS=Xenopus laevis GN=rcc2 PE=2 SV=1 373 550 4.0E-08
sp|Q15751|HERC1_HUMAN Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens GN=HERC1 PE=1 SV=2 336 584 5.0E-08
sp|Q15751|HERC1_HUMAN Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens GN=HERC1 PE=1 SV=2 343 582 8.0E-08
sp|Q52KW8|RCC2_XENLA Protein RCC2 homolog OS=Xenopus laevis GN=rcc2 PE=2 SV=1 211 538 8.0E-08
sp|Q8K1R7|NEK9_MOUSE Serine/threonine-protein kinase Nek9 OS=Mus musculus GN=Nek9 PE=1 SV=2 267 585 1.0E-07
sp|Q96I51|WBS16_HUMAN Williams-Beuren syndrome chromosomal region 16 protein OS=Homo sapiens GN=WBSCR16 PE=1 SV=2 322 559 1.0E-07
sp|Q86SG6|NEK8_HUMAN Serine/threonine-protein kinase Nek8 OS=Homo sapiens GN=NEK8 PE=1 SV=1 267 580 2.0E-07
sp|Q9N1T2|RPGR_CANLF X-linked retinitis pigmentosa GTPase regulator OS=Canis lupus familiaris GN=RPGR PE=2 SV=1 327 585 3.0E-07
sp|O95714|HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 435 582 3.0E-07
sp|Q4U2R1|HERC2_MOUSE E3 ubiquitin-protein ligase HERC2 OS=Mus musculus GN=Herc2 PE=1 SV=3 435 582 3.0E-07
sp|Q5RCZ7|RCBT2_PONAB RCC1 and BTB domain-containing protein 2 OS=Pongo abelii GN=RCBTB2 PE=2 SV=1 332 582 4.0E-07
sp|O95199|RCBT2_HUMAN RCC1 and BTB domain-containing protein 2 OS=Homo sapiens GN=RCBTB2 PE=1 SV=1 332 582 4.0E-07
sp|Q15751|HERC1_HUMAN Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens GN=HERC1 PE=1 SV=2 149 457 4.0E-07
sp|Q8NDN9|RCBT1_HUMAN RCC1 and BTB domain-containing protein 1 OS=Homo sapiens GN=RCBTB1 PE=2 SV=1 149 474 4.0E-07
sp|Q8BK67|RCC2_MOUSE Protein RCC2 OS=Mus musculus GN=Rcc2 PE=1 SV=1 149 471 4.0E-07
sp|Q8BTU7|RCCD1_MOUSE RCC1 domain-containing protein 1 OS=Mus musculus GN=Rccd1 PE=2 SV=2 323 484 4.0E-07
sp|Q91ZR4|NEK8_MOUSE Serine/threonine-protein kinase Nek8 OS=Mus musculus GN=Nek8 PE=1 SV=1 183 481 4.0E-07
sp|Q5RCZ7|RCBT2_PONAB RCC1 and BTB domain-containing protein 2 OS=Pongo abelii GN=RCBTB2 PE=2 SV=1 149 474 6.0E-07
sp|O95199|RCBT2_HUMAN RCC1 and BTB domain-containing protein 2 OS=Homo sapiens GN=RCBTB2 PE=1 SV=1 149 474 6.0E-07
sp|Q6NXM2|RCBT1_MOUSE RCC1 and BTB domain-containing protein 1 OS=Mus musculus GN=Rcbtb1 PE=2 SV=1 310 582 6.0E-07
sp|Q6NXM2|RCBT1_MOUSE RCC1 and BTB domain-containing protein 1 OS=Mus musculus GN=Rcbtb1 PE=2 SV=1 149 474 6.0E-07
sp|D3ZGQ5|NEK8_RAT Serine/threonine-protein kinase Nek8 OS=Rattus norvegicus GN=Nek8 PE=1 SV=1 183 481 6.0E-07
sp|Q92834|RPGR_HUMAN X-linked retinitis pigmentosa GTPase regulator OS=Homo sapiens GN=RPGR PE=1 SV=2 327 582 7.0E-07
sp|Q8IVU3|HERC6_HUMAN Probable E3 ubiquitin-protein ligase HERC6 OS=Homo sapiens GN=HERC6 PE=2 SV=2 439 584 1.0E-06
sp|Q6P798|RCBT2_RAT RCC1 and BTB domain-containing protein 2 OS=Rattus norvegicus GN=Rcbtb2 PE=2 SV=1 332 582 1.0E-06
sp|Q99LJ7|RCBT2_MOUSE RCC1 and BTB domain-containing protein 2 OS=Mus musculus GN=Rcbtb2 PE=2 SV=1 332 582 1.0E-06
sp|Q6NYE2|RCC2_DANRE Protein RCC2 homolog OS=Danio rerio GN=rcc2 PE=2 SV=1 373 586 2.0E-06
sp|Q8SSY6|SPKUL_DICDI Bifunctional serine/threonine-protein kinase/NEDD4-like E3 ubiquitin-protein ligase OS=Dictyostelium discoideum GN=DDB_G0276527 PE=3 SV=2 148 387 2.0E-06
sp|Q8IS20|GEFC_DICDI Ras guanine nucleotide exchange factor C OS=Dictyostelium discoideum GN=gefC PE=2 SV=1 419 579 2.0E-06
sp|Q5GLZ8|HERC4_HUMAN Probable E3 ubiquitin-protein ligase HERC4 OS=Homo sapiens GN=HERC4 PE=1 SV=1 403 584 3.0E-06
sp|Q9UII4|HERC5_HUMAN E3 ISG15--protein ligase HERC5 OS=Homo sapiens GN=HERC5 PE=1 SV=2 263 473 3.0E-06
sp|O95714|HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 149 425 3.0E-06
sp|Q4U2R1|HERC2_MOUSE E3 ubiquitin-protein ligase HERC2 OS=Mus musculus GN=Herc2 PE=1 SV=3 264 425 3.0E-06
sp|Q54VW7|GACGG_DICDI Rho GTPase-activating protein gacGG OS=Dictyostelium discoideum GN=gacGG PE=3 SV=1 185 473 3.0E-06
sp|Q9P2D0|IBTK_HUMAN Inhibitor of Bruton tyrosine kinase OS=Homo sapiens GN=IBTK PE=1 SV=3 392 546 3.0E-06
sp|Q9P2D0|IBTK_HUMAN Inhibitor of Bruton tyrosine kinase OS=Homo sapiens GN=IBTK PE=1 SV=3 278 473 4.0E-06
sp|Q6ZPR6|IBTK_MOUSE Inhibitor of Bruton tyrosine kinase OS=Mus musculus GN=Ibtk PE=1 SV=3 324 475 4.0E-06
sp|Q54X24|RCCDA_DICDI RCC1 domain-containing protein DDB_G0279253 OS=Dictyostelium discoideum GN=DDB_G0279253 PE=3 SV=1 282 412 4.0E-06
sp|Q86SG6|NEK8_HUMAN Serine/threonine-protein kinase Nek8 OS=Homo sapiens GN=NEK8 PE=1 SV=1 264 582 6.0E-06
sp|Q90XC2|NEK8_DANRE Serine/threonine-protein kinase Nek8 OS=Danio rerio GN=nek8 PE=2 SV=1 148 412 7.0E-06
sp|Q9P2D0|IBTK_HUMAN Inhibitor of Bruton tyrosine kinase OS=Homo sapiens GN=IBTK PE=1 SV=3 324 475 7.0E-06
sp|Q6P798|RCBT2_RAT RCC1 and BTB domain-containing protein 2 OS=Rattus norvegicus GN=Rcbtb2 PE=2 SV=1 149 474 8.0E-06
sp|Q6NYE2|RCC2_DANRE Protein RCC2 homolog OS=Danio rerio GN=rcc2 PE=2 SV=1 149 471 8.0E-06
sp|Q4U2R1|HERC2_MOUSE E3 ubiquitin-protein ligase HERC2 OS=Mus musculus GN=Herc2 PE=1 SV=3 400 582 8.0E-06
sp|Q54X24|RCCDA_DICDI RCC1 domain-containing protein DDB_G0279253 OS=Dictyostelium discoideum GN=DDB_G0279253 PE=3 SV=1 360 546 8.0E-06
sp|Q9VR91|HERC2_DROME Probable E3 ubiquitin-protein ligase HERC2 OS=Drosophila melanogaster GN=HERC2 PE=1 SV=3 343 575 1.0E-05
sp|Q99LJ7|RCBT2_MOUSE RCC1 and BTB domain-containing protein 2 OS=Mus musculus GN=Rcbtb2 PE=2 SV=1 149 474 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|622750
MPPRRSSRPAAAKPPSAPVSKSAAKAPARSRSQPARKRAASPSRDERPAPKRLRTAPPSQKSENIPPPSSRKPRS
KPSSAAKPQPTTRKRGRPKLGAITEAVESKETKPLEKKKVPKEPKQKPTPIPQSKPYLNPLPTPPPTSRPSPILF
VFGAGNFGQFGMGPDVLDSLTKPKRNQWVEEQISKGTFGEVGAGITAVAGGGLHTLFADEKGTVWSCGANDNAAL
GRITTDVPDPDNEGSFLDVDDLTSWPRPLQTLVDEHFRAVLVAAGDSIGAVVSDQGELRVWGTFRGMEGALGFSD
GKDKQHLPTPILTLSHKPGDYEKVSSVAAGNNHLVIVTTHGHLYTLGVGEQGQLGRKILERRKIHGTHPEKICLG
TRSRKAVKVAAGSYHSFAIDDNDDVWGWGLNTMGQTGTGWSSRDDDCVHFPQKVESLSRESLSGDTVVQIAAGEH
HTIFLTAAGKVYSCGRMDGSQLGLEDDNPAIIEWKEKYAEMFDGAVPQFLPTPTEVAFPDADDAVVQISTGVHNN
AVVTRGGALLTWGQGIQGELGCGDDEEVETPKVVVRKDGGSWFAVAVSCGGQHTLGLLKKK*
Coding >Agabi119p4|622750
ATGCCCCCCAGAAGGTCTTCTCGTCCTGCCGCTGCAAAACCGCCATCGGCCCCAGTCAGTAAATCTGCTGCAAAG
GCCCCTGCGAGATCCCGGAGTCAACCTGCCCGGAAACGTGCAGCTTCTCCCAGTCGGGACGAGCGTCCAGCGCCG
AAGCGTCTTCGCACTGCTCCCCCTAGTCAGAAGTCAGAAAATATCCCCCCACCATCTAGTAGGAAACCCCGCTCC
AAGCCTTCTAGCGCAGCCAAACCTCAGCCCACGACAAGGAAGAGAGGTCGTCCCAAACTTGGTGCCATTACCGAA
GCTGTTGAGTCGAAGGAAACGAAACCGTTGGAGAAAAAGAAGGTACCGAAAGAACCGAAGCAAAAGCCAACACCT
ATTCCTCAGTCAAAACCCTATCTTAATCCCTTACCCACTCCGCCTCCAACATCAAGACCCAGTCCTATCCTATTC
GTTTTCGGTGCTGGTAACTTTGGTCAATTTGGCATGGGCCCGGACGTCCTAGACTCGCTCACTAAGCCAAAACGA
AATCAATGGGTAGAGGAACAAATCTCAAAGGGCACTTTTGGTGAAGTCGGCGCTGGTATAACTGCTGTTGCTGGC
GGTGGCCTCCATACACTTTTCGCGGACGAGAAAGGGACGGTATGGTCTTGCGGTGCCAATGATAATGCCGCCCTT
GGTCGAATTACTACGGACGTTCCGGACCCTGACAATGAGGGTTCATTCCTCGACGTTGACGACCTCACAAGTTGG
CCCCGGCCACTACAAACATTAGTTGATGAGCATTTCCGTGCTGTGCTCGTTGCCGCTGGCGATAGCATTGGTGCG
GTGGTAAGCGACCAAGGTGAACTCCGCGTTTGGGGTACTTTCAGGGGCATGGAAGGAGCTCTCGGTTTCTCGGAT
GGCAAAGACAAACAACATCTTCCTACACCCATCCTTACTCTAAGCCATAAGCCTGGTGACTACGAAAAGGTTTCC
TCCGTAGCTGCCGGCAATAACCATCTAGTCATCGTCACGACTCATGGCCATCTTTATACCCTCGGTGTCGGCGAA
CAAGGCCAGCTCGGGAGGAAAATTTTAGAGCGTCGGAAAATTCACGGAACGCATCCCGAGAAAATTTGCCTTGGT
ACACGCTCTCGTAAAGCTGTCAAGGTCGCTGCCGGATCCTACCATTCTTTCGCCATTGATGACAATGACGATGTA
TGGGGATGGGGACTGAATACTATGGGCCAAACTGGTACTGGTTGGTCATCAAGAGATGATGACTGTGTACATTTC
CCGCAAAAGGTGGAGTCCCTCAGTAGGGAGAGCCTATCGGGTGACACTGTTGTCCAAATTGCCGCAGGCGAGCAC
CATACCATTTTCTTGACTGCGGCAGGGAAGGTATATTCTTGTGGACGTATGGACGGTAGTCAACTTGGTCTGGAG
GACGACAATCCCGCTATCATCGAGTGGAAAGAAAAATACGCTGAGATGTTTGATGGTGCAGTGCCACAATTTCTT
CCTACGCCAACAGAAGTGGCGTTCCCGGATGCCGATGACGCCGTCGTTCAGATATCTACTGGCGTGCATAACAAC
GCAGTAGTGACGCGCGGTGGGGCACTGTTAACATGGGGACAAGGCATTCAGGGTGAACTTGGTTGCGGCGATGAC
GAAGAAGTCGAGACGCCAAAGGTGGTTGTGCGGAAAGATGGTGGCTCGTGGTTCGCCGTGGCTGTTTCATGCGGC
GGTCAACATACACTCGGACTTCTGAAGAAGAAGTGA
Transcript >Agabi119p4|622750
ATGCCCCCCAGAAGGTCTTCTCGTCCTGCCGCTGCAAAACCGCCATCGGCCCCAGTCAGTAAATCTGCTGCAAAG
GCCCCTGCGAGATCCCGGAGTCAACCTGCCCGGAAACGTGCAGCTTCTCCCAGTCGGGACGAGCGTCCAGCGCCG
AAGCGTCTTCGCACTGCTCCCCCTAGTCAGAAGTCAGAAAATATCCCCCCACCATCTAGTAGGAAACCCCGCTCC
AAGCCTTCTAGCGCAGCCAAACCTCAGCCCACGACAAGGAAGAGAGGTCGTCCCAAACTTGGTGCCATTACCGAA
GCTGTTGAGTCGAAGGAAACGAAACCGTTGGAGAAAAAGAAGGTACCGAAAGAACCGAAGCAAAAGCCAACACCT
ATTCCTCAGTCAAAACCCTATCTTAATCCCTTACCCACTCCGCCTCCAACATCAAGACCCAGTCCTATCCTATTC
GTTTTCGGTGCTGGTAACTTTGGTCAATTTGGCATGGGCCCGGACGTCCTAGACTCGCTCACTAAGCCAAAACGA
AATCAATGGGTAGAGGAACAAATCTCAAAGGGCACTTTTGGTGAAGTCGGCGCTGGTATAACTGCTGTTGCTGGC
GGTGGCCTCCATACACTTTTCGCGGACGAGAAAGGGACGGTATGGTCTTGCGGTGCCAATGATAATGCCGCCCTT
GGTCGAATTACTACGGACGTTCCGGACCCTGACAATGAGGGTTCATTCCTCGACGTTGACGACCTCACAAGTTGG
CCCCGGCCACTACAAACATTAGTTGATGAGCATTTCCGTGCTGTGCTCGTTGCCGCTGGCGATAGCATTGGTGCG
GTGGTAAGCGACCAAGGTGAACTCCGCGTTTGGGGTACTTTCAGGGGCATGGAAGGAGCTCTCGGTTTCTCGGAT
GGCAAAGACAAACAACATCTTCCTACACCCATCCTTACTCTAAGCCATAAGCCTGGTGACTACGAAAAGGTTTCC
TCCGTAGCTGCCGGCAATAACCATCTAGTCATCGTCACGACTCATGGCCATCTTTATACCCTCGGTGTCGGCGAA
CAAGGCCAGCTCGGGAGGAAAATTTTAGAGCGTCGGAAAATTCACGGAACGCATCCCGAGAAAATTTGCCTTGGT
ACACGCTCTCGTAAAGCTGTCAAGGTCGCTGCCGGATCCTACCATTCTTTCGCCATTGATGACAATGACGATGTA
TGGGGATGGGGACTGAATACTATGGGCCAAACTGGTACTGGTTGGTCATCAAGAGATGATGACTGTGTACATTTC
CCGCAAAAGGTGGAGTCCCTCAGTAGGGAGAGCCTATCGGGTGACACTGTTGTCCAAATTGCCGCAGGCGAGCAC
CATACCATTTTCTTGACTGCGGCAGGGAAGGTATATTCTTGTGGACGTATGGACGGTAGTCAACTTGGTCTGGAG
GACGACAATCCCGCTATCATCGAGTGGAAAGAAAAATACGCTGAGATGTTTGATGGTGCAGTGCCACAATTTCTT
CCTACGCCAACAGAAGTGGCGTTCCCGGATGCCGATGACGCCGTCGTTCAGATATCTACTGGCGTGCATAACAAC
GCAGTAGTGACGCGCGGTGGGGCACTGTTAACATGGGGACAAGGCATTCAGGGTGAACTTGGTTGCGGCGATGAC
GAAGAAGTCGAGACGCCAAAGGTGGTTGTGCGGAAAGATGGTGGCTCGTGGTTCGCCGTGGCTGTTTCATGCGGC
GGTCAACATACACTCGGACTTCTGAAGAAGAAGTGA
Gene >Agabi119p4|622750
ATGCCCCCCAGAAGGTCTTCTCGTCCTGCCGCTGCAAAACCGCCATCGGCCCCAGTCAGTAAATCTGCTGCAAAG
GCCCCTGCGAGATCCCGGAGTCAACCTGCCCGGAAACGTGCAGCTTCTCCCAGTCGGGACGAGCGTCCAGCGCCG
AAGCGTCTTCGCACTGCTCCCCCTAGTCAGAAGTCAGAAAATATCCCCCCACCATCTAGTAGGAAACCCCGCTCC
AAGCCTTCTAGCGCAGCCAAACCTCAGCCCACGACAAGGAAGAGAGGTCGTCCCAAACTTGGTGCCATTACCGAA
GCTGTTGAGTCGAAGGAAACGAAACCGTTGGAGAAAAAGAAGGTACCGAAAGAACCGAAGCAAAAGCCAACACCT
ATTCCTCAGTCAAAACCCTATCTTAATCCCTTACCCACTCCGCCTCCAACATCAAGACCCAGTCCTATCCTATTC
GTTTTCGGTGCTGGTAACTTTGGTCAATTTGGCATGGGCCCGGACGTCCTAGACTCGCTCACTAAGCCAAAACGA
AATCAATGGGTAGAGGAACAAATCTCAAAGGGCACTTTTGGTGAAGTCGGCGCTGGTATAACTGCTGTTGCTGGC
GGTGGCCTCCATACACTTTTCGCGGACGAGAAAGGGACGGTACGTAGATAGTCTTCTTCTCATCCTTCACTTATT
GACTATCGTTGCTGTAGGTATGGTCTTGCGGTGCCAATGATAATGCCGCCCTTGGTCGAATTACTACGGACGTTC
CGGACCCTGACAATGAGGGTTCATTCCTCGACGTTGACGACCTCACAAGTTGGCCCCGGCCACTACAAACATTAG
TTGATGAGCATTTCCGTGCTGTGCTCGTTGCCGCTGGCGATAGCATTGGTGCGGTGGTAAGCGACCAAGGTGAAC
TCCGCGTTTGGGGTACTTTCAGGGTAAGTACACCTTTTCAAGTCGTTTTTTTCCTCCCTAATCGTAGCCTAGGGC
ATGGAAGGAGCTCTCGGTTTCTCGGATGGCAAAGACAAACAACATCTTCCTACACCCATCCTTACTCTAAGCCAT
AAGCCTGGTGACTACGAAAAGGTTTCCTCCGTAGCTGCCGGCAATAACCATCTAGTCATCGTCACGACTCATGGC
CATCTTTATACCCTCGGTGTCGGCGAACAAGGCCAGCTCGGGAGGAAAATTTTAGAGCGTCGGAAAATTCACGGA
ACGCATCCCGAGAAAATTTGCCTTGGTACACGCTCTCGTAAAGCTGTCAAGGTCGCTGCCGGATCCTACCATTCT
TTCGCCATTGATGACAATGACGATGTATGGGGATGGGGACTGAATACTATGGGCCAAACTGGTACTGGTTGGTCA
TCAAGAGATGATGACTGTGTACATTTCCCGCAAAAGGTGGAGTCCCTCAGTAGGGAGAGCCTATCGGGTGACACT
GTTGTCCAAATTGCCGCAGGCGAGCACCATACCATTTTCTTGACTGCGGCAGGGAAGGTATATTCTTGTGGACGT
ATGGACGGTAGTCAACTTGGTCTGGAGGACGACAATCCCGCTATCATCGAGTGGAAAGAAAAATACGCTGAGATG
TTTGATGGTGCAGTGCCACAATTTCTTCCTACGCCAACAGAAGTGGCGTTCCCGGATGCCGATGACGCCGTCGTT
CAGATATCTACTGGCGTGCATAACAACGCAGTAGTGACGCGCGGTGGGGCACTGTTAACATGGGGACAAGGCATT
CAGGGTGAACTTGGTTGCGGCGATGACGAAGAAGTCGAGACGCCAAAGGTGGTTGTGCGGAAAGATGGTGGCTCG
TGGTTCGCCGTGGCTGTTTCATGCGGCGGTCAACATACACTCGGACTTCTGAAGAAGAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail