Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|617150
Gene name
Locationscaffold_04:65482..72525
Strand+
Gene length (bp)7043
Transcript length (bp)6678
Coding sequence length (bp)6678
Protein length (aa) 2226

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase) 1.2E-31 1436 1697
PF14529 Exo_endo_phos_2 Endonuclease-reverse transcriptase 6.5E-07 1083 1173
PF14223 Retrotran_gag_2 gag-polypeptide of LTR copia-type 1.2E-06 85 195

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9NBX4|RTXE_DROME Probable RNA-directed DNA polymerase from transposon X-element OS=Drosophila melanogaster GN=X-elementORF2 PE=3 SV=1 1275 1785 8.0E-21
sp|Q95SX7|RTBS_DROME Probable RNA-directed DNA polymerase from transposon BS OS=Drosophila melanogaster GN=RTase PE=2 SV=1 1369 1783 2.0E-19
sp|P21328|RTJK_DROME RNA-directed DNA polymerase from mobile element jockey OS=Drosophila melanogaster GN=pol PE=1 SV=1 1373 1785 9.0E-18
sp|P21329|RTJK_DROFU RNA-directed DNA polymerase from mobile element jockey OS=Drosophila funebris GN=jockeypol PE=1 SV=1 1369 1785 4.0E-17
sp|P16425|Y2R2_DROME Putative 115 kDa protein in type-1 retrotransposable element R1DM OS=Drosophila melanogaster GN=R1A1-elementORF2 PE=3 SV=1 1278 1891 3.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9NBX4|RTXE_DROME Probable RNA-directed DNA polymerase from transposon X-element OS=Drosophila melanogaster GN=X-elementORF2 PE=3 SV=1 1275 1785 8.0E-21
sp|Q95SX7|RTBS_DROME Probable RNA-directed DNA polymerase from transposon BS OS=Drosophila melanogaster GN=RTase PE=2 SV=1 1369 1783 2.0E-19
sp|P21328|RTJK_DROME RNA-directed DNA polymerase from mobile element jockey OS=Drosophila melanogaster GN=pol PE=1 SV=1 1373 1785 9.0E-18
sp|P21329|RTJK_DROFU RNA-directed DNA polymerase from mobile element jockey OS=Drosophila funebris GN=jockeypol PE=1 SV=1 1369 1785 4.0E-17
sp|P16425|Y2R2_DROME Putative 115 kDa protein in type-1 retrotransposable element R1DM OS=Drosophila melanogaster GN=R1A1-elementORF2 PE=3 SV=1 1278 1891 3.0E-16
sp|Q03277|PO11_BRACO Retrovirus-related Pol polyprotein from type-1 retrotransposable element R1 (Fragment) OS=Bradysia coprophila PE=3 SV=1 1374 1817 3.0E-14
sp|P16423|POLR_DROME Retrovirus-related Pol polyprotein from type-2 retrotransposable element R2DM OS=Drosophila melanogaster GN=pol PE=3 SV=1 1364 1702 3.0E-13
sp|O00370|LORF2_HUMAN LINE-1 retrotransposable element ORF2 protein OS=Homo sapiens PE=1 SV=1 1357 1710 2.0E-12
sp|P11369|LORF2_MOUSE LINE-1 retrotransposable element ORF2 protein OS=Mus musculus GN=Pol PE=1 SV=2 1368 1666 1.0E-08
sp|P08548|LIN1_NYCCO LINE-1 reverse transcriptase homolog OS=Nycticebus coucang PE=3 SV=1 1369 1701 3.0E-08
sp|Q03279|PO21_BRACO Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 (Fragment) OS=Bradysia coprophila PE=3 SV=1 1364 1699 4.0E-06
sp|P14381|YTX2_XENLA Transposon TX1 uncharacterized 149 kDa protein OS=Xenopus laevis PE=3 SV=1 1363 1640 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|617150
MGPGWANIGTNSNALPKLSGAKNYDTWARRVKNALILIQHKDSTLTAWDVSGSSHPLPTLPTDPTELAKENAIRM
TLKLQATALIESTLLDHMIQEEFNSPRDLWGKMKLNYGVRGPTFVYERLQSLLNFKVQDTQDPSGQIAEFVATCS
QITATGATLHDLLQTMMLLSALPARMESTIGIILLRPQKCPISPLRKRELLSPRLGETLRTSPPPGLNRPDRLRD
GRMPHLEHPGKISSSSSVLMDSSSKSRKASSKGNKLRKELNLTMIRSARELVDKQLLEPLFLGDSDLFDRVTTMS
ADSSGTGRLPENPPRGRGRGASLPPPPGGSWSSSGLPSSRGRLADARPASRAASRDPSRVRGATSQQTLDAFVTR
DQVYSRADDWEREASPPPPSSSADPTTPRLRTSSRSSTAAPASPTPQRMSLDPEDLSPSALTFSGAAGSDEANDR
ALIQSLYAASDFLKGRIGQFRRAQPSEFLLTHVATPLFEVSAYAALISHLDPPVREVEKIVEKIVYREGRAPPSN
SQRMDTEPDPGPGPAEPPRRSDAPGSRPGPKVARGIPPPRRPDPKGKGKAPSRPPVPNYSTHPGRTSYAGMAAKP
PAPPPAVPPPAAATPGVNPLVSLAMAYPHIPADALIRMHQSLSENRAPDLARPSAVNKAKHTTNGPSRRQILLSA
PSVASIDVEACTRLLNSKLSAQSSELRVESTRAAYGGWSIVTNRAASDSQLDAVSKILRSDFLPKPVAPFTVSLP
RSTSYLKVLDVPRFSSGRTPTSSDAVVAALGASPLFGDIVLAGKPRLVANSKRRDGLQRHSSGRPFNLVTDPSAS
WGLVLTGVSPFANAVGFGDTLNFPARHALRCVPSVTNRTPLMPIGLKRRAAEVTPRLILPGNPPLMAWVVPIPRV
AATVPESMRLLLGPAPSGLIALTVIGSRIGIPRSPRGNISDIRVFCQNVNRSYPHVDTLLQTLKDIDVLFFQEPP
RQLIRHTISTVSPDGDPVWGSPRHPDWVPLESKVTGDREARVLTYVHRRLAKLRPALRTDLIAHEDIQVISLHPG
GNDVVFLMNVYSDSNHRAIQFLGGKVDSLPHFSYVGGDFNCHSSEWDPACPHHRSPAPALLEHMADIGVYWQRPV
NHGPTHTPHNEDLQGSVIDLIFSPMFGNEDFLPVLTHGEQGRSDHVPLVMRVPIREVDVRISRMTIDPDSKEELD
FCNEVRTRLGEIKLDWLDTREGVEDCAQAIARVFAEGWEHHSAERIITVHSKSWWNSECTDAKLLLAGERSPENI
SIFRRACSAAKRAFFDKRINDIAVETKRPWDLMSWVGPRKLPPSEAIIHNGQACTDMPSLWEALHSTYNSAADKP
VDLGIIEEVPALEERDWAPFSHKELTDALSACSSRSSPGPDHITWRHLKRVLPDDDPSLVVRSLADACFEQGIWP
DYFKSSSSVIIPKPGKATYSTPHAFRPIVLLNTLGKLIEKMISTRLQFDGVKYGLFHAHQFGGIRQRSTEDAGAF
LTHLIRAGWAKGLKTSVIAFDVAQFFPSLNHEVLLGVLSRQGFPASVRNFFASYLVGRRTSYRWNVFESPDFLAD
VGVGQGSALSPVLSALYFSLVMKVFYQRMSHSECDVLSYVDDGTIVCQSRALDQNLPKLSEAYEVMFDILTAVGL
DMEHSKSEIFHFTRERGNYNPSIVLPVGPFTEARPLRPQTYWRYLGIFFDRTLTFREHVRFYSTKAFSTVRAMGM
LGNSLRGLSPMHKRLLYRSCVVPVATYGMNLWYHGFSKSKGHLESLRKMQRRAALWITGAFRTSPIGGVESLAGL
IPIHLHIKKLAARADMRVVTLSPTHPIRTLVPGKGLLEETPLRHRFHVTHFEDEVRDKIKSSVCGIGHQISQFTE
RFHADSELARPGHRLMDVYGHRIKFYEASKVIKNNELVNRLNRLHFAAEMVPNSVIVGVDGAVPKGNRTQAVAAA
IVRKGGQPYYEEAVPFGKATSTDVELRAIVIGLEKAVSYNPSLITLFTDSLSMARLSVDPSHHPGQFDSHLVCVN
LSRWLANDPRREVAFVHTRSHLKWGIHHEAHTLAKRASFPFNPGIPPRVTFNFIRRKATEACKDEWPRLFSSADY
RGHHFLRLCDSTDKPARPSYVGGGPWLPFFGDHPSFCARAIRCILGHAPMGEFRARFNIAGRRDCEYCGTGANQT
RAHLLRQCNMLVRPRRFRMYPYYLGELYQYLRDNTWLFSFNPLPREARRM*
Coding >Agabi119p4|617150
ATGGGCCCCGGTTGGGCAAATATTGGTACCAACTCCAATGCTCTCCCCAAGCTCTCCGGCGCCAAGAACTATGAT
ACTTGGGCCCGTCGCGTCAAGAACGCCTTGATCCTTATCCAGCATAAGGACTCCACCCTGACCGCATGGGATGTT
AGCGGCAGTTCTCACCCGCTCCCTACTTTGCCTACCGACCCTACTGAATTGGCAAAGGAGAATGCAATCAGGATG
ACTCTCAAATTGCAGGCAACTGCGTTGATCGAGTCTACCCTCCTGGACCATATGATCCAGGAGGAATTCAACAGC
CCAAGAGACCTCTGGGGTAAAATGAAGTTGAATTACGGAGTCCGAGGACCGACTTTCGTCTATGAAAGGCTCCAG
TCCCTCCTAAACTTTAAGGTTCAAGATACACAGGATCCATCCGGACAGATTGCTGAATTCGTCGCAACCTGTTCG
CAAATCACTGCCACTGGGGCGACTCTTCACGACTTGCTCCAAACCATGATGCTCCTCTCCGCTCTTCCGGCTCGT
ATGGAATCTACAATCGGAATCATCCTCCTTCGGCCGCAAAAGTGTCCGATCTCACCATTGAGAAAGCGAGAGCTA
CTATCGCCGCGGCTTGGCGAAACCCTCAGAACCTCGCCGCCGCCAGGTTTAAACCGTCCGGACAGGCTCCGCGAT
GGCAGAATGCCACACCTGGAACATCCGGGCAAAATCAGCAGCAGCAGCAGCGTCCTCATGGACAGCAGCAGCAAA
AGCCGCAAGGCCAGCAGCAAAGGCAACAAGCTCCGCAAGGAACTAAACCTGACGATGATAAGAAGCGCAAGAGAA
CTCGTGGACAAGCAGCTTCTTGAACCGCTGTTCCTTGGTGACTCTGATCTCTTCGATCGTGTTACCACCATGTCT
GCCGACTCCTCTGGAACCGGCCGACTCCCCGAAAACCCCCCCCGCGGCCGCGGGCGTGGGGCATCTTTGCCGCCG
CCCCCTGGGGGCTCCTGGTCTTCTTCCGGCTTGCCCTCCTCGCGAGGCAGGCTCGCTGATGCTCGCCCTGCGTCT
CGGGCAGCGTCTCGGGATCCCTCTCGTGTGAGGGGTGCCACTTCCCAGCAAACGCTCGATGCGTTTGTTACTCGT
GATCAAGTGTATTCTCGGGCTGACGATTGGGAGAGAGAGGCTTCGCCTCCTCCCCCGTCTTCGTCTGCGGATCCA
ACAACTCCCCGTTTGCGCACCTCCTCGAGGTCGTCGACAGCTGCACCGGCATCCCCTACCCCACAGAGGATGTCT
CTCGACCCGGAAGACCTGTCACCTTCCGCCCTTACGTTCAGTGGGGCGGCAGGAAGTGATGAAGCCAATGACAGG
GCCCTCATCCAATCTCTCTATGCTGCCTCGGATTTTCTGAAGGGGCGCATTGGCCAATTTCGACGAGCTCAACCT
TCTGAGTTCCTCCTTACACACGTCGCTACTCCGTTGTTCGAAGTCTCTGCTTATGCGGCCTTAATCTCTCATTTG
GACCCGCCCGTTCGAGAGGTAGAGAAGATCGTTGAGAAGATCGTCTACCGCGAAGGCCGCGCTCCCCCCTCCAAC
TCTCAGCGCATGGACACTGAGCCCGATCCGGGTCCAGGTCCTGCTGAACCTCCTCGGCGTTCCGACGCTCCTGGT
TCCAGGCCAGGTCCGAAGGTAGCTCGGGGTATTCCTCCACCTCGCCGCCCTGATCCTAAGGGCAAGGGAAAGGCG
CCTTCTCGCCCTCCCGTCCCTAATTATTCTACCCACCCGGGTAGAACTTCTTACGCAGGTATGGCTGCCAAGCCG
CCTGCTCCTCCTCCCGCTGTTCCGCCTCCGGCGGCGGCTACTCCTGGGGTTAACCCGTTGGTCTCTTTGGCCATG
GCATACCCTCATATCCCCGCTGATGCGCTCATTCGAATGCATCAGTCTCTCTCTGAGAACCGTGCTCCGGACCTC
GCTCGGCCTTCGGCTGTGAACAAGGCCAAGCACACTACCAATGGCCCTTCTAGGCGCCAGATCCTTCTGTCGGCA
CCTTCGGTTGCCTCCATCGACGTCGAAGCCTGTACCAGGCTTCTGAATTCTAAACTCTCAGCTCAGAGTTCTGAA
CTCCGAGTCGAGTCTACTCGTGCCGCCTACGGTGGATGGTCGATTGTGACCAACCGCGCGGCCTCTGATTCCCAG
CTGGACGCGGTCTCTAAGATTCTGCGTTCTGACTTCCTCCCGAAGCCTGTGGCGCCGTTCACAGTCTCGCTTCCA
CGTTCGACATCTTATCTCAAGGTGCTGGACGTTCCTCGTTTTTCATCGGGCAGGACTCCGACCTCTTCGGACGCT
GTCGTCGCTGCATTGGGGGCTTCCCCTTTGTTCGGTGACATTGTTCTCGCTGGCAAGCCTCGTCTTGTCGCTAAC
TCCAAGCGGCGGGACGGTCTGCAAAGACACTCGTCGGGAAGACCATTCAATTTGGTAACAGATCCCTCCGCATCG
TGGGGGCTAGTCCTAACCGGGGTGTCTCCCTTTGCCAACGCTGTTGGATTTGGGGACACTCTCAACTTTCCTGCA
AGGCACGCTCTCCGTTGTGTGCCATCTGTAACGAACCGCACACCACTGATGCCCATCGGGCTCAAGCGTCGTGCT
GCCGAGGTAACCCCAAGGCTAATCCTCCCCGGGAACCCACCGCTGATGGCGTGGGTTGTCCCCATCCCCCGCGTT
GCCGCAACTGTGCCGGAGAGCATGCGGCTTCTGCTAGGGCCTGCCCCTTCTGGTCTCATCGCTTTGACGGTGATT
GGATCAAGAATAGGAATTCCCAGATCTCCTAGGGGTAATATTAGTGATATTCGTGTATTCTGTCAGAATGTGAAT
AGATCCTATCCGCATGTTGACACCTTGTTACAGACGTTGAAAGATATCGACGTTCTTTTCTTCCAAGAGCCACCC
AGGCAATTGATTAGGCACACTATCTCCACGGTTTCACCGGATGGAGATCCTGTATGGGGTTCGCCCCGGCATCCG
GACTGGGTTCCGCTGGAATCTAAAGTCACAGGTGATCGCGAGGCACGGGTTTTGACTTATGTCCACCGTCGCCTC
GCTAAACTTCGACCCGCGCTTCGCACGGATCTCATTGCCCATGAGGACATCCAGGTCATTTCTCTCCATCCAGGG
GGGAATGATGTTGTGTTCCTCATGAATGTATACTCAGATTCAAATCATCGTGCTATCCAGTTTCTGGGCGGCAAG
GTTGATTCACTTCCACACTTTTCGTATGTGGGAGGAGATTTTAATTGTCATTCGAGTGAGTGGGACCCTGCGTGT
CCTCATCACCGCTCTCCCGCCCCCGCATTGCTGGAGCACATGGCGGACATTGGAGTTTACTGGCAGCGGCCAGTC
AACCATGGTCCTACGCACACTCCTCATAACGAGGATCTACAGGGGTCGGTCATTGATTTGATCTTCTCTCCTATG
TTTGGCAATGAGGATTTCTTGCCGGTTCTTACCCATGGCGAACAGGGCAGATCTGATCATGTCCCGCTCGTCATG
CGTGTTCCTATTCGGGAGGTGGATGTTCGCATCTCCAGAATGACTATTGATCCGGACTCGAAGGAGGAGCTTGAC
TTCTGCAATGAGGTTCGAACTAGATTGGGCGAAATCAAACTTGATTGGCTCGATACGCGTGAAGGGGTCGAGGAT
TGTGCGCAAGCCATTGCTCGGGTCTTTGCGGAGGGTTGGGAACATCACTCCGCAGAACGCATTATCACAGTACAT
TCTAAGTCCTGGTGGAATTCAGAATGTACGGACGCGAAGTTGCTGTTAGCGGGGGAGAGATCCCCCGAGAACATT
TCTATTTTTCGCCGCGCATGCAGTGCGGCCAAACGTGCATTCTTTGATAAGCGTATCAATGACATTGCAGTCGAA
ACTAAGCGGCCGTGGGACCTCATGAGTTGGGTTGGGCCGAGGAAACTTCCACCGTCAGAGGCCATTATTCACAAT
GGCCAGGCGTGCACAGACATGCCTTCCCTTTGGGAGGCGTTACATTCCACATACAATTCTGCCGCTGATAAGCCT
GTGGACTTGGGTATCATTGAGGAGGTTCCGGCTCTCGAAGAGAGAGATTGGGCTCCGTTCTCGCACAAGGAGTTG
ACCGACGCTTTGTCGGCCTGCTCCTCGCGCTCTTCCCCAGGTCCCGATCACATAACGTGGCGGCATCTGAAAAGG
GTTCTGCCAGATGATGATCCATCACTGGTTGTCCGTTCTCTGGCTGATGCCTGCTTTGAGCAAGGCATCTGGCCG
GATTATTTTAAGTCGTCTAGCTCGGTCATCATTCCGAAGCCGGGTAAGGCGACGTACTCTACTCCTCATGCGTTC
AGGCCCATTGTGCTTCTGAACACGCTGGGAAAGCTCATTGAGAAAATGATCTCTACTCGCTTACAATTTGACGGT
GTCAAATATGGGCTTTTCCATGCTCATCAGTTCGGTGGAATACGGCAACGTTCTACTGAGGATGCTGGTGCATTC
CTTACTCATCTCATCCGCGCGGGATGGGCTAAGGGCCTCAAGACTAGTGTCATAGCGTTTGACGTGGCACAGTTC
TTCCCTTCCTTAAATCACGAGGTTCTCCTCGGGGTTCTTTCTCGGCAGGGGTTTCCGGCTTCGGTCAGGAACTTC
TTTGCCTCTTATCTTGTGGGACGTCGAACGAGTTACAGATGGAACGTGTTTGAGTCTCCGGATTTTCTAGCGGAC
GTGGGCGTCGGGCAGGGATCTGCCCTCTCTCCAGTCCTGTCTGCTCTCTATTTCTCCTTGGTTATGAAGGTTTTC
TACCAGCGTATGTCGCACTCTGAGTGCGATGTCCTGTCTTATGTGGATGATGGTACCATTGTGTGCCAGTCTCGT
GCACTCGATCAGAATCTTCCTAAGCTCTCTGAAGCTTATGAGGTAATGTTCGATATTCTAACCGCTGTCGGTCTA
GACATGGAACATTCCAAGTCTGAGATCTTTCATTTTACCCGGGAACGTGGTAATTACAACCCGTCTATTGTCCTT
CCCGTTGGACCATTTACGGAAGCTCGTCCTCTCCGCCCACAGACCTACTGGAGGTATTTGGGCATCTTCTTTGAT
CGGACTCTCACATTCCGTGAGCATGTCCGTTTCTACTCTACTAAGGCTTTCTCCACGGTTCGCGCCATGGGGATG
CTTGGAAACTCGCTAAGGGGACTCTCTCCTATGCATAAGCGTCTGCTTTACAGATCATGCGTGGTCCCAGTGGCT
ACGTACGGCATGAATTTGTGGTATCATGGATTTTCTAAGTCCAAGGGCCACCTTGAGTCCCTGAGGAAGATGCAG
CGCCGCGCTGCCCTCTGGATTACTGGTGCGTTTCGCACTTCCCCGATTGGAGGGGTTGAGTCGCTTGCCGGGCTT
ATCCCTATCCATCTTCACATCAAGAAGCTGGCGGCTCGCGCTGATATGCGGGTGGTCACTTTATCTCCGACGCAC
CCAATTCGGACTCTTGTTCCGGGTAAGGGCCTGCTGGAAGAGACGCCGCTTCGGCATCGCTTCCATGTCACTCAC
TTCGAGGACGAAGTGCGCGATAAGATCAAATCCTCAGTGTGTGGAATTGGTCATCAAATTTCGCAGTTTACGGAA
CGGTTTCATGCTGACTCCGAGTTAGCGAGACCGGGTCATCGTCTGATGGATGTTTATGGGCATCGCATCAAATTC
TATGAGGCTAGCAAGGTCATTAAGAATAATGAACTTGTTAATCGTCTGAATCGTCTCCACTTTGCTGCGGAGATG
GTTCCTAACTCAGTTATTGTTGGGGTTGATGGGGCGGTCCCGAAAGGGAACCGTACCCAGGCCGTGGCAGCAGCT
ATTGTTCGCAAGGGTGGACAGCCTTACTATGAAGAGGCGGTGCCATTCGGAAAAGCCACGTCTACGGATGTTGAG
CTTCGTGCTATTGTGATTGGACTGGAGAAGGCCGTCTCCTACAATCCATCACTGATTACCTTATTCACTGACTCG
CTCTCTATGGCGCGATTATCAGTGGACCCCTCTCACCACCCGGGTCAGTTTGATTCTCACCTGGTGTGTGTGAAC
TTATCCCGATGGCTTGCCAACGATCCTCGTCGGGAAGTTGCATTCGTCCACACTCGGTCTCATCTGAAGTGGGGC
ATCCATCATGAGGCGCATACGCTTGCTAAGCGTGCCTCTTTTCCATTTAATCCGGGGATTCCTCCTAGGGTTACT
TTCAATTTTATAAGGCGTAAGGCGACGGAAGCCTGCAAGGATGAGTGGCCGCGGTTATTCAGCTCGGCTGATTAT
CGGGGTCATCATTTCTTACGACTGTGTGATAGCACGGACAAGCCGGCGCGACCTTCCTATGTTGGGGGAGGTCCT
TGGCTTCCTTTCTTTGGTGATCATCCCTCGTTTTGTGCGAGGGCTATCCGATGTATCCTCGGTCATGCCCCCATG
GGGGAATTCCGAGCCAGATTCAACATTGCGGGCCGCCGCGACTGCGAGTACTGTGGTACTGGTGCGAACCAGACC
CGGGCTCATTTGCTTAGACAATGCAACATGCTTGTCCGCCCCAGGCGCTTCAGGATGTACCCGTACTACCTTGGA
GAGCTCTATCAATATTTGAGGGATAACACGTGGCTGTTTTCCTTCAATCCCCTCCCTCGGGAGGCACGACGCATG
TGA
Transcript >Agabi119p4|617150
ATGGGCCCCGGTTGGGCAAATATTGGTACCAACTCCAATGCTCTCCCCAAGCTCTCCGGCGCCAAGAACTATGAT
ACTTGGGCCCGTCGCGTCAAGAACGCCTTGATCCTTATCCAGCATAAGGACTCCACCCTGACCGCATGGGATGTT
AGCGGCAGTTCTCACCCGCTCCCTACTTTGCCTACCGACCCTACTGAATTGGCAAAGGAGAATGCAATCAGGATG
ACTCTCAAATTGCAGGCAACTGCGTTGATCGAGTCTACCCTCCTGGACCATATGATCCAGGAGGAATTCAACAGC
CCAAGAGACCTCTGGGGTAAAATGAAGTTGAATTACGGAGTCCGAGGACCGACTTTCGTCTATGAAAGGCTCCAG
TCCCTCCTAAACTTTAAGGTTCAAGATACACAGGATCCATCCGGACAGATTGCTGAATTCGTCGCAACCTGTTCG
CAAATCACTGCCACTGGGGCGACTCTTCACGACTTGCTCCAAACCATGATGCTCCTCTCCGCTCTTCCGGCTCGT
ATGGAATCTACAATCGGAATCATCCTCCTTCGGCCGCAAAAGTGTCCGATCTCACCATTGAGAAAGCGAGAGCTA
CTATCGCCGCGGCTTGGCGAAACCCTCAGAACCTCGCCGCCGCCAGGTTTAAACCGTCCGGACAGGCTCCGCGAT
GGCAGAATGCCACACCTGGAACATCCGGGCAAAATCAGCAGCAGCAGCAGCGTCCTCATGGACAGCAGCAGCAAA
AGCCGCAAGGCCAGCAGCAAAGGCAACAAGCTCCGCAAGGAACTAAACCTGACGATGATAAGAAGCGCAAGAGAA
CTCGTGGACAAGCAGCTTCTTGAACCGCTGTTCCTTGGTGACTCTGATCTCTTCGATCGTGTTACCACCATGTCT
GCCGACTCCTCTGGAACCGGCCGACTCCCCGAAAACCCCCCCCGCGGCCGCGGGCGTGGGGCATCTTTGCCGCCG
CCCCCTGGGGGCTCCTGGTCTTCTTCCGGCTTGCCCTCCTCGCGAGGCAGGCTCGCTGATGCTCGCCCTGCGTCT
CGGGCAGCGTCTCGGGATCCCTCTCGTGTGAGGGGTGCCACTTCCCAGCAAACGCTCGATGCGTTTGTTACTCGT
GATCAAGTGTATTCTCGGGCTGACGATTGGGAGAGAGAGGCTTCGCCTCCTCCCCCGTCTTCGTCTGCGGATCCA
ACAACTCCCCGTTTGCGCACCTCCTCGAGGTCGTCGACAGCTGCACCGGCATCCCCTACCCCACAGAGGATGTCT
CTCGACCCGGAAGACCTGTCACCTTCCGCCCTTACGTTCAGTGGGGCGGCAGGAAGTGATGAAGCCAATGACAGG
GCCCTCATCCAATCTCTCTATGCTGCCTCGGATTTTCTGAAGGGGCGCATTGGCCAATTTCGACGAGCTCAACCT
TCTGAGTTCCTCCTTACACACGTCGCTACTCCGTTGTTCGAAGTCTCTGCTTATGCGGCCTTAATCTCTCATTTG
GACCCGCCCGTTCGAGAGGTAGAGAAGATCGTTGAGAAGATCGTCTACCGCGAAGGCCGCGCTCCCCCCTCCAAC
TCTCAGCGCATGGACACTGAGCCCGATCCGGGTCCAGGTCCTGCTGAACCTCCTCGGCGTTCCGACGCTCCTGGT
TCCAGGCCAGGTCCGAAGGTAGCTCGGGGTATTCCTCCACCTCGCCGCCCTGATCCTAAGGGCAAGGGAAAGGCG
CCTTCTCGCCCTCCCGTCCCTAATTATTCTACCCACCCGGGTAGAACTTCTTACGCAGGTATGGCTGCCAAGCCG
CCTGCTCCTCCTCCCGCTGTTCCGCCTCCGGCGGCGGCTACTCCTGGGGTTAACCCGTTGGTCTCTTTGGCCATG
GCATACCCTCATATCCCCGCTGATGCGCTCATTCGAATGCATCAGTCTCTCTCTGAGAACCGTGCTCCGGACCTC
GCTCGGCCTTCGGCTGTGAACAAGGCCAAGCACACTACCAATGGCCCTTCTAGGCGCCAGATCCTTCTGTCGGCA
CCTTCGGTTGCCTCCATCGACGTCGAAGCCTGTACCAGGCTTCTGAATTCTAAACTCTCAGCTCAGAGTTCTGAA
CTCCGAGTCGAGTCTACTCGTGCCGCCTACGGTGGATGGTCGATTGTGACCAACCGCGCGGCCTCTGATTCCCAG
CTGGACGCGGTCTCTAAGATTCTGCGTTCTGACTTCCTCCCGAAGCCTGTGGCGCCGTTCACAGTCTCGCTTCCA
CGTTCGACATCTTATCTCAAGGTGCTGGACGTTCCTCGTTTTTCATCGGGCAGGACTCCGACCTCTTCGGACGCT
GTCGTCGCTGCATTGGGGGCTTCCCCTTTGTTCGGTGACATTGTTCTCGCTGGCAAGCCTCGTCTTGTCGCTAAC
TCCAAGCGGCGGGACGGTCTGCAAAGACACTCGTCGGGAAGACCATTCAATTTGGTAACAGATCCCTCCGCATCG
TGGGGGCTAGTCCTAACCGGGGTGTCTCCCTTTGCCAACGCTGTTGGATTTGGGGACACTCTCAACTTTCCTGCA
AGGCACGCTCTCCGTTGTGTGCCATCTGTAACGAACCGCACACCACTGATGCCCATCGGGCTCAAGCGTCGTGCT
GCCGAGGTAACCCCAAGGCTAATCCTCCCCGGGAACCCACCGCTGATGGCGTGGGTTGTCCCCATCCCCCGCGTT
GCCGCAACTGTGCCGGAGAGCATGCGGCTTCTGCTAGGGCCTGCCCCTTCTGGTCTCATCGCTTTGACGGTGATT
GGATCAAGAATAGGAATTCCCAGATCTCCTAGGGGTAATATTAGTGATATTCGTGTATTCTGTCAGAATGTGAAT
AGATCCTATCCGCATGTTGACACCTTGTTACAGACGTTGAAAGATATCGACGTTCTTTTCTTCCAAGAGCCACCC
AGGCAATTGATTAGGCACACTATCTCCACGGTTTCACCGGATGGAGATCCTGTATGGGGTTCGCCCCGGCATCCG
GACTGGGTTCCGCTGGAATCTAAAGTCACAGGTGATCGCGAGGCACGGGTTTTGACTTATGTCCACCGTCGCCTC
GCTAAACTTCGACCCGCGCTTCGCACGGATCTCATTGCCCATGAGGACATCCAGGTCATTTCTCTCCATCCAGGG
GGGAATGATGTTGTGTTCCTCATGAATGTATACTCAGATTCAAATCATCGTGCTATCCAGTTTCTGGGCGGCAAG
GTTGATTCACTTCCACACTTTTCGTATGTGGGAGGAGATTTTAATTGTCATTCGAGTGAGTGGGACCCTGCGTGT
CCTCATCACCGCTCTCCCGCCCCCGCATTGCTGGAGCACATGGCGGACATTGGAGTTTACTGGCAGCGGCCAGTC
AACCATGGTCCTACGCACACTCCTCATAACGAGGATCTACAGGGGTCGGTCATTGATTTGATCTTCTCTCCTATG
TTTGGCAATGAGGATTTCTTGCCGGTTCTTACCCATGGCGAACAGGGCAGATCTGATCATGTCCCGCTCGTCATG
CGTGTTCCTATTCGGGAGGTGGATGTTCGCATCTCCAGAATGACTATTGATCCGGACTCGAAGGAGGAGCTTGAC
TTCTGCAATGAGGTTCGAACTAGATTGGGCGAAATCAAACTTGATTGGCTCGATACGCGTGAAGGGGTCGAGGAT
TGTGCGCAAGCCATTGCTCGGGTCTTTGCGGAGGGTTGGGAACATCACTCCGCAGAACGCATTATCACAGTACAT
TCTAAGTCCTGGTGGAATTCAGAATGTACGGACGCGAAGTTGCTGTTAGCGGGGGAGAGATCCCCCGAGAACATT
TCTATTTTTCGCCGCGCATGCAGTGCGGCCAAACGTGCATTCTTTGATAAGCGTATCAATGACATTGCAGTCGAA
ACTAAGCGGCCGTGGGACCTCATGAGTTGGGTTGGGCCGAGGAAACTTCCACCGTCAGAGGCCATTATTCACAAT
GGCCAGGCGTGCACAGACATGCCTTCCCTTTGGGAGGCGTTACATTCCACATACAATTCTGCCGCTGATAAGCCT
GTGGACTTGGGTATCATTGAGGAGGTTCCGGCTCTCGAAGAGAGAGATTGGGCTCCGTTCTCGCACAAGGAGTTG
ACCGACGCTTTGTCGGCCTGCTCCTCGCGCTCTTCCCCAGGTCCCGATCACATAACGTGGCGGCATCTGAAAAGG
GTTCTGCCAGATGATGATCCATCACTGGTTGTCCGTTCTCTGGCTGATGCCTGCTTTGAGCAAGGCATCTGGCCG
GATTATTTTAAGTCGTCTAGCTCGGTCATCATTCCGAAGCCGGGTAAGGCGACGTACTCTACTCCTCATGCGTTC
AGGCCCATTGTGCTTCTGAACACGCTGGGAAAGCTCATTGAGAAAATGATCTCTACTCGCTTACAATTTGACGGT
GTCAAATATGGGCTTTTCCATGCTCATCAGTTCGGTGGAATACGGCAACGTTCTACTGAGGATGCTGGTGCATTC
CTTACTCATCTCATCCGCGCGGGATGGGCTAAGGGCCTCAAGACTAGTGTCATAGCGTTTGACGTGGCACAGTTC
TTCCCTTCCTTAAATCACGAGGTTCTCCTCGGGGTTCTTTCTCGGCAGGGGTTTCCGGCTTCGGTCAGGAACTTC
TTTGCCTCTTATCTTGTGGGACGTCGAACGAGTTACAGATGGAACGTGTTTGAGTCTCCGGATTTTCTAGCGGAC
GTGGGCGTCGGGCAGGGATCTGCCCTCTCTCCAGTCCTGTCTGCTCTCTATTTCTCCTTGGTTATGAAGGTTTTC
TACCAGCGTATGTCGCACTCTGAGTGCGATGTCCTGTCTTATGTGGATGATGGTACCATTGTGTGCCAGTCTCGT
GCACTCGATCAGAATCTTCCTAAGCTCTCTGAAGCTTATGAGGTAATGTTCGATATTCTAACCGCTGTCGGTCTA
GACATGGAACATTCCAAGTCTGAGATCTTTCATTTTACCCGGGAACGTGGTAATTACAACCCGTCTATTGTCCTT
CCCGTTGGACCATTTACGGAAGCTCGTCCTCTCCGCCCACAGACCTACTGGAGGTATTTGGGCATCTTCTTTGAT
CGGACTCTCACATTCCGTGAGCATGTCCGTTTCTACTCTACTAAGGCTTTCTCCACGGTTCGCGCCATGGGGATG
CTTGGAAACTCGCTAAGGGGACTCTCTCCTATGCATAAGCGTCTGCTTTACAGATCATGCGTGGTCCCAGTGGCT
ACGTACGGCATGAATTTGTGGTATCATGGATTTTCTAAGTCCAAGGGCCACCTTGAGTCCCTGAGGAAGATGCAG
CGCCGCGCTGCCCTCTGGATTACTGGTGCGTTTCGCACTTCCCCGATTGGAGGGGTTGAGTCGCTTGCCGGGCTT
ATCCCTATCCATCTTCACATCAAGAAGCTGGCGGCTCGCGCTGATATGCGGGTGGTCACTTTATCTCCGACGCAC
CCAATTCGGACTCTTGTTCCGGGTAAGGGCCTGCTGGAAGAGACGCCGCTTCGGCATCGCTTCCATGTCACTCAC
TTCGAGGACGAAGTGCGCGATAAGATCAAATCCTCAGTGTGTGGAATTGGTCATCAAATTTCGCAGTTTACGGAA
CGGTTTCATGCTGACTCCGAGTTAGCGAGACCGGGTCATCGTCTGATGGATGTTTATGGGCATCGCATCAAATTC
TATGAGGCTAGCAAGGTCATTAAGAATAATGAACTTGTTAATCGTCTGAATCGTCTCCACTTTGCTGCGGAGATG
GTTCCTAACTCAGTTATTGTTGGGGTTGATGGGGCGGTCCCGAAAGGGAACCGTACCCAGGCCGTGGCAGCAGCT
ATTGTTCGCAAGGGTGGACAGCCTTACTATGAAGAGGCGGTGCCATTCGGAAAAGCCACGTCTACGGATGTTGAG
CTTCGTGCTATTGTGATTGGACTGGAGAAGGCCGTCTCCTACAATCCATCACTGATTACCTTATTCACTGACTCG
CTCTCTATGGCGCGATTATCAGTGGACCCCTCTCACCACCCGGGTCAGTTTGATTCTCACCTGGTGTGTGTGAAC
TTATCCCGATGGCTTGCCAACGATCCTCGTCGGGAAGTTGCATTCGTCCACACTCGGTCTCATCTGAAGTGGGGC
ATCCATCATGAGGCGCATACGCTTGCTAAGCGTGCCTCTTTTCCATTTAATCCGGGGATTCCTCCTAGGGTTACT
TTCAATTTTATAAGGCGTAAGGCGACGGAAGCCTGCAAGGATGAGTGGCCGCGGTTATTCAGCTCGGCTGATTAT
CGGGGTCATCATTTCTTACGACTGTGTGATAGCACGGACAAGCCGGCGCGACCTTCCTATGTTGGGGGAGGTCCT
TGGCTTCCTTTCTTTGGTGATCATCCCTCGTTTTGTGCGAGGGCTATCCGATGTATCCTCGGTCATGCCCCCATG
GGGGAATTCCGAGCCAGATTCAACATTGCGGGCCGCCGCGACTGCGAGTACTGTGGTACTGGTGCGAACCAGACC
CGGGCTCATTTGCTTAGACAATGCAACATGCTTGTCCGCCCCAGGCGCTTCAGGATGTACCCGTACTACCTTGGA
GAGCTCTATCAATATTTGAGGGATAACACGTGGCTGTTTTCCTTCAATCCCCTCCCTCGGGAGGCACGACGCATG
TGA
Gene >Agabi119p4|617150
ATGGGCCCCGGTTGGTGCATCTATGGATGATCATTTGATCTCTAGACCAACCGCTTTTGGATGGACATTCTCTAG
CCCATTTAGAATAGCCTATAGATAGCATGTTGTACCCTAGATCAGAGACTTACTGACCGATCCGGGTTGCAGGGC
AAATATTGGTACCAACTCCAATGCTCTCCCCAAGCTCTCCGGCGCCAAGAACTATGATACTTGGGCCCGTCGCGT
CAAGAACGCCTTGATCCTTATCCAGCATAAGGACTCCACCCTGACCGCATGGGATGTTAGCGGCAGTTCTCACCC
GCTCCCTACTTTGCCTACCGACCCTACTGAATTGGCAAAGGAGAATGCAATCAGGATGACTCTCAAATTGCAGGC
AACTGCGTTGATCGAGTCTACCCTCCTGGACCATATGATCCAGGAGGAATTCAACAGCCCAAGAGACCTCTGGGG
TAAAATGAAGTTGAATTACGGAGTCCGAGGACCGACTTTCGTCTATGAAAGGCTCCAGTCCCTCCTAAACTTTAA
GGTTCAAGATACACAGGATCCATCCGGACAGATTGCTGAATTCGTCGCAACCTGTTCGCAAATCACTGCCACTGG
GGCGACTCTTCACGACTTGCTCCAAACCATGATGCTCCTCTCCGCTCTTCCGGCTCGTATGGAATCTACAATCGG
AATCATCCTCCTTCGGCCGCAAAAGTGTCCGATCTCACCATTGAGAAAGCGAGAGCTACTATCGCCGCGGCTTGG
CGAAACCCTCAGAACCTCGCCGCCGCCAGGTTTAAACCGTCCGGACAGGCTCCGCGATGGCAGAATGCCACACCT
GGAACATCCGGGCAAAATCAGCAGCAGCAGCAGCGTCCTCATGGACAGCAGCAGCAAAAGCCGCAAGGCCAGCAG
CAAAGGCAACAAGCTCCGCAAGGAACTAAACCTGACGATGATAAGAAGCGCAAGAGAACTCGTGGACAAGCAGCT
TCTTGAACCGGTACCACCACCATCAAGGACCCAAACAACTACAAACATCTCCCCGTTGTCGCTCTTCGTGCCTGT
AGCTGTTCCTTGGTGACTCTGATCTCTTCGATCGTGTTACCACCATGTCTGCCGACTCCTCTGGAACCGGCCGAC
TCCCCGAAAACCCCCCCCGCGGCCGCGGGCGTGGGGCATCTTTGCCGCCGCCCCCTGGGGGCTCCTGGTCTTCTT
CCGGCTTGCCCTCCTCGCGAGGCAGGCTCGCTGATGCTCGCCCTGCGTCTCGGGCAGCGTCTCGGGATCCCTCTC
GTGTGAGGGGTGCCACTTCCCAGCAAACGCTCGATGCGTTTGTTACTCGTGATCAAGTGTATTCTCGGGCTGACG
ATTGGGAGAGAGAGGCTTCGCCTCCTCCCCCGTCTTCGTCTGCGGATCCAACAACTCCCCGTTTGCGCACCTCCT
CGAGGTCGTCGACAGCTGCACCGGCATCCCCTACCCCACAGAGGATGTCTCTCGACCCGGAAGACCTGTCACCTT
CCGCCCTTACGTTCAGTGGGGCGGCAGGAAGTGATGAAGCCAATGACAGGGCCCTCATCCAATCTCTCTATGCTG
CCTCGGATTTTCTGAAGGGGCGCATTGGCCAATTTCGACGAGCTCAACCTTCTGAGTTCCTCCTTACACACGTCG
CTACTCCGTTGTTCGAAGTGGCTTCCACTCTCAGATCCGTTTGGGAGTTTACTCCTTACGGCTGAATCCGGTGAC
AAGGTCTCTGCTTATGCGGCCTTAATCTCTCATTTGGACCCGCCCGTTCGAGAGGTAGAGAAGATCGTTGAGAAG
ATCGTCTACCGCGAAGGCCGCGCTCCCCCCTCCAACTCTCAGCGCATGGACACTGAGCCCGATCCGGGTCCAGGT
CCTGCTGAACCTCCTCGGCGTTCCGACGCTCCTGGTTCCAGGCCAGGTCCGAAGGTAGCTCGGGGTATTCCTCCA
CCTCGCCGCCCTGATCCTAAGGGCAAGGGAAAGGCGCCTTCTCGCCCTCCCGTCCCTAATTATTCTACCCACCCG
GGTAGAACTTCTTACGCAGGTATGGCTGCCAAGCCGCCTGCTCCTCCTCCCGCTGTTCCGCCTCCGGCGGCGGCT
ACTCCTGGGGTTAACCCGTTGGTCTCTTTGGCCATGGCATACCCTCATATCCCCGCTGATGCGCTCATTCGAATG
CATCAGTCTCTCTCTGAGAACCGTGCTCCGGACCTCGCTCGGCCTTCGGCTGTGAACAAGGCCAAGCACACTACC
AATGGCCCTTCTAGGCGCCAGATCCTTCTGTCGGCACCTTCGGTTGCCTCCATCGACGTCGAAGCCTGTACCAGG
CTTCTGAATTCTAAACTCTCAGCTCAGAGTTCTGAACTCCGAGTCGAGTCTACTCGTGCCGCCTACGGTGGATGG
TCGATTGTGACCAACCGCGCGGCCTCTGATTCCCAGCTGGACGCGGTCTCTAAGATTCTGCGTTCTGACTTCCTC
CCGAAGCCTGTGGCGCCGTTCACAGTCTCGCTTCCACGTTCGACATCTTATCTCAAGGTGCTGGACGTTCCTCGT
TTTTCATCGGGCAGGACTCCGACCTCTTCGGACGCTGTCGTCGCTGCATTGGGGGCTTCCCCTTTGTTCGGTGAC
ATTGTTCTCGCTGGCAAGCCTCGTCTTGTCGCTAACTCCAAGCGGTCTGACACAGTGACCGCTTACTTCGACATC
TGGGATTCTCAGGCGGGACGGTCTGCAAAGACACTCGTCGGGAAGACCATTCAATTTGGTAACAGATCCCTCCGC
ATCGTGGGGGCTAGTCCTAACCGGGGTGTCTCCCTTTGCCAACGCTGTTGGATTTGGGGACACTCTCAACTTTCC
TGCAAGGCACGCTCTCCGTTGTGTGCCATCTGTAACGAACCGCACACCACTGATGCCCATCGGGCTCAAGCGTCG
TGCTGCCGAGGTAACCCCAAGGCTAATCCTCCCCGGGAACCCACCGCTGATGGCGTGGGTTGTCCCCATCCCCCG
CGTTGCCGCAACTGTGCCGGAGAGCATGCGGCTTCTGCTAGGGCCTGCCCCTTCTGGTCTCATCGCTTTGACGGT
GATTGGATCAAGAATAGGAATTCCCAGGTACGCCGCTTGCGCAGTGGACGTCCAAATCCTCAAACTAATATCATT
TAATTATGCCTAGATCTCCTAGGGGTAATATTAGTGATATTCGTGTATTCTGTCAGAATGTGAATAGATCCTATC
CGCATGTTGACACCTTGTTACAGACGTTGAAAGATATCGACGTTCTTTTCTTCCAAGAGCCACCCAGGCAATTGA
TTAGGCACACTATCTCCACGGTTTCACCGGATGGAGATCCTGTATGGGGTTCGCCCCGGCATCCGGACTGGGTTC
CGCTGGAATCTAAAGTCACAGGTGATCGCGAGGCACGGGTTTTGACTTATGTCCACCGTCGCCTCGCTAAACTTC
GACCCGCGCTTCGCACGGATCTCATTGCCCATGAGGACATCCAGGTCATTTCTCTCCATCCAGGGGGGAATGATG
TTGTGTTCCTCATGAATGTATACTCAGATTCAAATCATCGTGCTATCCAGTTTCTGGGCGGCAAGGTTGATTCAC
TTCCACACTTTTCGTATGTGGGAGGAGATTTTAATTGTCATTCGAGTGAGTGGGACCCTGCGTGTCCTCATCACC
GCTCTCCCGCCCCCGCATTGCTGGAGCACATGGCGGACATTGGAGTTTACTGGCAGCGGCCAGTCAACCATGGTC
CTACGCACACTCCTCATAACGAGGATCTACAGGGGTCGGTCATTGATTTGATCTTCTCTCCTATGTTTGGCAATG
AGGATTTCTTGCCGGTTCTTACCCATGGCGAACAGGGCAGATCTGATCATGTCCCGCTCGTCATGCGTGTTCCTA
TTCGGGAGGTGGATGTTCGCATCTCCAGAATGACTATTGATCCGGACTCGAAGGAGGAGCTTGACTTCTGCAATG
AGGTTCGAACTAGATTGGGCGAAATCAAACTTGATTGGCTCGATACGCGTGAAGGGGTCGAGGATTGTGCGCAAG
CCATTGCTCGGGTCTTTGCGGAGGGTTGGGAACATCACTCCGCAGAACGCATTATCACAGTACATTCTAAGTCCT
GGTGGAATTCAGAATGTACGGACGCGAAGTTGCTGTTAGCGGGGGAGAGATCCCCCGAGAACATTTCTATTTTTC
GCCGCGCATGCAGTGCGGCCAAACGTGCATTCTTTGATAAGCGTATCAATGACATTGCAGTCGAAACTAAGCGGC
CGTGGGACCTCATGAGTTGGGTTGGGCCGAGGAAACTTCCACCGTCAGAGGCCATTATTCACAATGGCCAGGCGT
GCACAGACATGCCTTCCCTTTGGGAGGCGTTACATTCCACATACAATTCTGCCGCTGATAAGCCTGTGGACTTGG
GTATCATTGAGGAGGTTCCGGCTCTCGAAGAGAGAGATTGGGCTCCGTTCTCGCACAAGGAGTTGACCGACGCTT
TGTCGGCCTGCTCCTCGCGCTCTTCCCCAGGTCCCGATCACATAACGTGGCGGCATCTGAAAAGGGTTCTGCCAG
ATGATGATCCATCACTGGTTGTCCGTTCTCTGGCTGATGCCTGCTTTGAGCAAGGCATCTGGCCGGATTATTTTA
AGTCGTCTAGCTCGGTCATCATTCCGAAGCCGGGTAAGGCGACGTACTCTACTCCTCATGCGTTCAGGCCCATTG
TGCTTCTGAACACGCTGGGAAAGCTCATTGAGAAAATGATCTCTACTCGCTTACAATTTGACGGTGTCAAATATG
GGCTTTTCCATGCTCATCAGTTCGGTGGAATACGGCAACGTTCTACTGAGGATGCTGGTGCATTCCTTACTCATC
TCATCCGCGCGGGATGGGCTAAGGGCCTCAAGACTAGTGTCATAGCGTTTGACGTGGCACAGTTCTTCCCTTCCT
TAAATCACGAGGTTCTCCTCGGGGTTCTTTCTCGGCAGGGGTTTCCGGCTTCGGTCAGGAACTTCTTTGCCTCTT
ATCTTGTGGGACGTCGAACGAGTTACAGATGGAACGTGTTTGAGTCTCCGGATTTTCTAGCGGACGTGGGCGTCG
GGCAGGGATCTGCCCTCTCTCCAGTCCTGTCTGCTCTCTATTTCTCCTTGGTTATGAAGGTTTTCTACCAGCGTA
TGTCGCACTCTGAGTGCGATGTCCTGTCTTATGTGGATGATGGTACCATTGTGTGCCAGTCTCGTGCACTCGATC
AGAATCTTCCTAAGCTCTCTGAAGCTTATGAGGTAATGTTCGATATTCTAACCGCTGTCGGTCTAGACATGGAAC
ATTCCAAGTCTGAGATCTTTCATTTTACCCGGGAACGTGGTAATTACAACCCGTCTATTGTCCTTCCCGTTGGAC
CATTTACGGAAGCTCGTCCTCTCCGCCCACAGACCTACTGGAGGTATTTGGGCATCTTCTTTGATCGGACTCTCA
CATTCCGTGAGCATGTCCGTTTCTACTCTACTAAGGCTTTCTCCACGGTTCGCGCCATGGGGATGCTTGGAAACT
CGCTAAGGGGACTCTCTCCTATGCATAAGCGTCTGCTTTACAGATCATGCGTGGTCCCAGTGGCTACGTACGGCA
TGAATTTGTGGTATCATGGATTTTCTAAGTCCAAGGGCCACCTTGAGTCCCTGAGGAAGATGCAGCGCCGCGCTG
CCCTCTGGATTACTGGTGCGTTTCGCACTTCCCCGATTGGAGGGGTTGAGTCGCTTGCCGGGCTTATCCCTATCC
ATCTTCACATCAAGAAGCTGGCGGCTCGCGCTGATATGCGGGTGGTCACTTTATCTCCGACGCACCCAATTCGGA
CTCTTGTTCCGGGTAAGGGCCTGCTGGAAGAGACGCCGCTTCGGCATCGCTTCCATGTCACTCACTTCGAGGACG
AAGTGCGCGATAAGATCAAATCCTCAGTGTGTGGAATTGGTCATCAAATTTCGCAGTTTACGGAACGGTTTCATG
CTGACTCCGAGTTAGCGAGACCGGGTCATCGTCTGATGGATGTTTATGGGCATCGCATCAAATTCTATGAGGCTA
GCAAGGTCATTAAGAATAATGAACTTGTTAATCGTCTGAATCGTCTCCACTTTGCTGCGGAGATGGTTCCTAACT
CAGTTATTGTTGGGGTTGATGGGGCGGTCCCGAAAGGGAACCGTACCCAGGCCGTGGCAGCAGCTATTGTTCGCA
AGGGTGGACAGCCTTACTATGAAGAGGCGGTGCCATTCGGAAAAGCCACGTCTACGGATGTTGAGCTTCGTGCTA
TTGTGATTGGACTGGAGAAGGCCGTCTCCTACAATCCATCACTGATTACCTTATTCACTGACTCGCTCTCTATGG
CGCGATTATCAGTGGACCCCTCTCACCACCCGGGTCAGTTTGATTCTCACCTGGTGTGTGTGAACTTATCCCGAT
GGCTTGCCAACGATCCTCGTCGGGAAGTTGCATTCGTCCACACTCGGTCTCATCTGAAGTGGGGCATCCATCATG
AGGCGCATACGCTTGCTAAGCGTGCCTCTTTTCCATTTAATCCGGGGATTCCTCCTAGGGTTACTTTCAATTTTA
TAAGGCGTAAGGCGACGGAAGCCTGCAAGGATGAGTGGCCGCGGTTATTCAGCTCGGCTGATTATCGGGGTCATC
ATTTCTTACGACTGTGTGATAGCACGGACAAGCCGGCGCGACCTTCCTATGTTGGGGGAGGTCCTTGGCTTCCTT
TCTTTGGTGATCATCCCTCGTTTTGTGCGAGGGCTATCCGATGTATCCTCGGTCATGCCCCCATGGGGGAATTCC
GAGCCAGATTCAACATTGCGGGCCGCCGCGACTGCGAGTACTGTGGTACTGGTGCGAACCAGACCCGGGCTCATT
TGCTTAGACAATGCAACATGCTTGTCCGCCCCAGGCGCTTCAGGATGTACCCGTACTACCTTGGAGAGCTCTATC
AATATTTGAGGGATAACACGTGGCTGTTTTCCTTCAATCCCCTCCCTCGGGAGGCACGACGCATGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail