Protein ID | Agabi119p4|616250 |
Gene name | |
Location | scaffold_04:22501..22967 |
Strand | - |
Gene length (bp) | 466 |
Transcript length (bp) | 357 |
Coding sequence length (bp) | 357 |
Protein length (aa) | 119 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF00346 | Complex1_49kDa | Respiratory-chain NADH dehydrogenase, 49 Kd subunit | 8.2E-24 | 4 | 87 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q37619|NDUS2_PROWI | NADH-ubiquinone oxidoreductase 49 kDa subunit OS=Prototheca wickerhamii GN=NAD7 PE=3 SV=1 | 1 | 86 | 4.0E-36 |
sp|O21270|NDUS2_RECAM | NADH-ubiquinone oxidoreductase 49 kDa subunit OS=Reclinomonas americana GN=NAD7 PE=3 SV=1 | 1 | 86 | 2.0E-34 |
sp|P22142|NDUS2_NEUCR | NADH-ubiquinone oxidoreductase 49 kDa subunit, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuo-49 PE=1 SV=2 | 1 | 87 | 1.0E-31 |
sp|Q91WD5|NDUS2_MOUSE | NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial OS=Mus musculus GN=Ndufs2 PE=1 SV=1 | 2 | 86 | 4.0E-31 |
sp|P17694|NDUS2_BOVIN | NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial OS=Bos taurus GN=NDUFS2 PE=1 SV=2 | 2 | 86 | 6.0E-31 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q37619|NDUS2_PROWI | NADH-ubiquinone oxidoreductase 49 kDa subunit OS=Prototheca wickerhamii GN=NAD7 PE=3 SV=1 | 1 | 86 | 4.0E-36 |
sp|O21270|NDUS2_RECAM | NADH-ubiquinone oxidoreductase 49 kDa subunit OS=Reclinomonas americana GN=NAD7 PE=3 SV=1 | 1 | 86 | 2.0E-34 |
sp|P22142|NDUS2_NEUCR | NADH-ubiquinone oxidoreductase 49 kDa subunit, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuo-49 PE=1 SV=2 | 1 | 87 | 1.0E-31 |
sp|Q91WD5|NDUS2_MOUSE | NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial OS=Mus musculus GN=Ndufs2 PE=1 SV=1 | 2 | 86 | 4.0E-31 |
sp|P17694|NDUS2_BOVIN | NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial OS=Bos taurus GN=NDUFS2 PE=1 SV=2 | 2 | 86 | 6.0E-31 |
sp|P93306|NDUS2_ARATH | NADH dehydrogenase [ubiquinone] iron-sulfur protein 2 OS=Arabidopsis thaliana GN=NAD7 PE=2 SV=2 | 1 | 86 | 6.0E-31 |
sp|Q37720|NDUS2_PYLLI | NADH-ubiquinone oxidoreductase 49 kDa subunit OS=Pylaiella littoralis GN=NAD7 PE=3 SV=1 | 1 | 87 | 1.0E-30 |
sp|Q36450|NDUS2_NICSY | NADH dehydrogenase [ubiquinone] iron-sulfur protein 2 OS=Nicotiana sylvestris GN=NAD7 PE=2 SV=1 | 1 | 87 | 4.0E-30 |
sp|Q9TC96|NDUS2_NEPOL | NADH dehydrogenase [ubiquinone] iron-sulfur protein 2 OS=Nephroselmis olivacea GN=NAD7 PE=3 SV=1 | 1 | 86 | 4.0E-30 |
sp|Q37384|NDUS2_ACACA | NADH-ubiquinone oxidoreductase 49 kDa subunit OS=Acanthamoeba castellanii GN=NAD7 PE=3 SV=1 | 1 | 86 | 8.0E-30 |
sp|Q641Y2|NDUS2_RAT | NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial OS=Rattus norvegicus GN=Ndufs2 PE=1 SV=1 | 2 | 87 | 1.0E-29 |
sp|A5CES2|NUOD_ORITB | NADH-quinone oxidoreductase subunit D OS=Orientia tsutsugamushi (strain Boryong) GN=nuoD PE=3 SV=1 | 1 | 86 | 3.0E-29 |
sp|B3CSH1|NUOD_ORITI | NADH-quinone oxidoreductase subunit D OS=Orientia tsutsugamushi (strain Ikeda) GN=nuoD PE=3 SV=1 | 1 | 86 | 1.0E-28 |
sp|Q93873|NDUS2_CAEEL | Probable NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial OS=Caenorhabditis elegans GN=gas-1 PE=3 SV=2 | 2 | 86 | 7.0E-28 |
sp|Q9TAJ7|NDUS2_CAFRO | NADH-ubiquinone oxidoreductase 49 kDa subunit OS=Cafeteria roenbergensis GN=NAD7 PE=3 SV=1 | 1 | 86 | 7.0E-28 |
sp|Q5GTF8|NUOD_WOLTR | NADH-quinone oxidoreductase subunit D OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=nuoD PE=3 SV=1 | 1 | 86 | 2.0E-27 |
sp|Q1RJI9|NUOD_RICBR | NADH-quinone oxidoreductase subunit D OS=Rickettsia bellii (strain RML369-C) GN=nuoD PE=3 SV=2 | 1 | 86 | 4.0E-27 |
sp|A8GX80|NUOD_RICB8 | NADH-quinone oxidoreductase subunit D OS=Rickettsia bellii (strain OSU 85-389) GN=nuoD PE=3 SV=1 | 1 | 86 | 4.0E-27 |
sp|Q9ZDH4|NUOD_RICPR | NADH-quinone oxidoreductase subunit D OS=Rickettsia prowazekii (strain Madrid E) GN=nuoD PE=3 SV=1 | 1 | 86 | 4.0E-27 |
sp|Q4UM08|NUOD_RICFE | NADH-quinone oxidoreductase subunit D OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=nuoD PE=3 SV=1 | 1 | 114 | 4.0E-27 |
sp|B3CLH1|NUOD_WOLPP | NADH-quinone oxidoreductase subunit D OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=nuoD PE=3 SV=1 | 1 | 86 | 4.0E-27 |
sp|Q68X19|NUOD_RICTY | NADH-quinone oxidoreductase subunit D OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=nuoD PE=3 SV=2 | 1 | 86 | 5.0E-27 |
sp|A8GN50|NUOD_RICAH | NADH-quinone oxidoreductase subunit D OS=Rickettsia akari (strain Hartford) GN=nuoD PE=3 SV=2 | 1 | 86 | 5.0E-27 |
sp|Q2LCR5|NDUS2_DICCI | NADH-ubiquinone oxidoreductase 49 kDa subunit OS=Dictyostelium citrinum GN=nad7 PE=3 SV=1 | 1 | 86 | 1.0E-26 |
sp|Q23883|NDUS2_DICDI | NADH-ubiquinone oxidoreductase 49 kDa subunit OS=Dictyostelium discoideum GN=nad7 PE=1 SV=1 | 1 | 86 | 1.0E-26 |
sp|Q73HJ8|NUOD_WOLPM | NADH-quinone oxidoreductase subunit D OS=Wolbachia pipientis wMel GN=nuoD PE=3 SV=1 | 1 | 86 | 2.0E-26 |
sp|A8F1C5|NUOD_RICM5 | NADH-quinone oxidoreductase subunit D OS=Rickettsia massiliae (strain Mtu5) GN=nuoD PE=3 SV=2 | 1 | 86 | 6.0E-26 |
sp|Q92ID8|NUOD_RICCN | NADH-quinone oxidoreductase subunit D OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=nuoD PE=3 SV=2 | 1 | 86 | 6.0E-26 |
sp|A8GRR5|NUOD_RICRS | NADH-quinone oxidoreductase subunit D OS=Rickettsia rickettsii (strain Sheila Smith) GN=nuoD PE=3 SV=1 | 1 | 86 | 6.0E-26 |
sp|B0BX71|NUOD_RICRO | NADH-quinone oxidoreductase subunit D OS=Rickettsia rickettsii (strain Iowa) GN=nuoD PE=3 SV=2 | 1 | 86 | 7.0E-26 |
sp|Q3YS37|NUOD_EHRCJ | NADH-quinone oxidoreductase subunit D OS=Ehrlichia canis (strain Jake) GN=nuoD PE=3 SV=1 | 3 | 86 | 1.0E-25 |
sp|A8EZ86|NUOD_RICCK | NADH-quinone oxidoreductase subunit D OS=Rickettsia canadensis (strain McKiel) GN=nuoD PE=3 SV=2 | 1 | 86 | 1.0E-25 |
sp|Q0MQG4|NDUS2_GORGO | NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial OS=Gorilla gorilla gorilla GN=NDUFS2 PE=2 SV=1 | 2 | 86 | 1.0E-25 |
sp|Q0MQG5|NDUS2_PANTR | NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial OS=Pan troglodytes GN=NDUFS2 PE=2 SV=1 | 2 | 86 | 2.0E-25 |
sp|O75306|NDUS2_HUMAN | NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial OS=Homo sapiens GN=NDUFS2 PE=1 SV=2 | 2 | 86 | 2.0E-25 |
sp|Q0MQG3|NDUS2_PONPY | NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial OS=Pongo pygmaeus GN=NDUFS2 PE=2 SV=1 | 2 | 86 | 2.0E-25 |
sp|Q2GGK7|NUOD_EHRCR | NADH-quinone oxidoreductase subunit D OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=nuoD PE=3 SV=1 | 3 | 86 | 3.0E-25 |
sp|A9HRT9|NUOD_GLUDA | NADH-quinone oxidoreductase subunit D OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=nuoD PE=3 SV=2 | 1 | 86 | 4.0E-25 |
sp|Q2W3I7|NUOD_MAGSA | NADH-quinone oxidoreductase subunit D OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=nuoD PE=3 SV=1 | 1 | 86 | 9.0E-25 |
sp|Q4FM88|NUOD_PELUB | NADH-quinone oxidoreductase subunit D OS=Pelagibacter ubique (strain HTCC1062) GN=nuoD PE=3 SV=1 | 1 | 86 | 2.0E-24 |
sp|Q0C1E4|NUOD_HYPNA | NADH-quinone oxidoreductase subunit D OS=Hyphomonas neptunium (strain ATCC 15444) GN=nuoD PE=3 SV=1 | 3 | 86 | 2.0E-24 |
sp|A6U7W6|NUOD1_SINMW | NADH-quinone oxidoreductase subunit D 1 OS=Sinorhizobium medicae (strain WSM419) GN=nuoD1 PE=3 SV=1 | 1 | 86 | 8.0E-24 |
sp|Q215I0|NUOD_RHOPB | NADH-quinone oxidoreductase subunit D OS=Rhodopseudomonas palustris (strain BisB18) GN=nuoD PE=3 SV=1 | 1 | 86 | 3.0E-23 |
sp|Q2IWY2|NUOD_RHOP2 | NADH-quinone oxidoreductase subunit D OS=Rhodopseudomonas palustris (strain HaA2) GN=nuoD PE=3 SV=1 | 1 | 86 | 3.0E-23 |
sp|P56907|NUOD1_RHIME | NADH-quinone oxidoreductase subunit D 1 OS=Rhizobium meliloti (strain 1021) GN=nuoD1 PE=3 SV=1 | 1 | 86 | 3.0E-23 |
sp|Q5FGV3|NUOD_EHRRG | NADH-quinone oxidoreductase subunit D OS=Ehrlichia ruminantium (strain Gardel) GN=nuoD PE=3 SV=1 | 1 | 86 | 4.0E-23 |
sp|Q5HB88|NUOD_EHRRW | NADH-quinone oxidoreductase subunit D OS=Ehrlichia ruminantium (strain Welgevonden) GN=nuoD PE=3 SV=1 | 1 | 86 | 4.0E-23 |
sp|Q163Q5|NUOD_ROSDO | NADH-quinone oxidoreductase subunit D OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=nuoD PE=3 SV=1 | 1 | 86 | 7.0E-23 |
sp|Q0APY7|NUOD_MARMM | NADH-quinone oxidoreductase subunit D OS=Maricaulis maris (strain MCS10) GN=nuoD PE=3 SV=1 | 1 | 86 | 8.0E-23 |
sp|A5EK97|NUOD_BRASB | NADH-quinone oxidoreductase subunit D OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=nuoD PE=3 SV=1 | 1 | 86 | 1.0E-22 |
sp|A4YVK9|NUOD_BRASO | NADH-quinone oxidoreductase subunit D OS=Bradyrhizobium sp. (strain ORS278) GN=nuoD PE=3 SV=1 | 1 | 86 | 1.0E-22 |
sp|Q07NM3|NUOD_RHOP5 | NADH-quinone oxidoreductase subunit D OS=Rhodopseudomonas palustris (strain BisA53) GN=nuoD PE=3 SV=1 | 1 | 86 | 1.0E-22 |
sp|B0SZ49|NUOD_CAUSK | NADH-quinone oxidoreductase subunit D OS=Caulobacter sp. (strain K31) GN=nuoD PE=3 SV=1 | 1 | 86 | 1.0E-22 |
sp|Q2GJY9|NUOD_ANAPZ | NADH-quinone oxidoreductase subunit D OS=Anaplasma phagocytophilum (strain HZ) GN=nuoD PE=3 SV=1 | 1 | 86 | 2.0E-22 |
sp|A1B495|NUOD_PARDP | NADH-quinone oxidoreductase subunit D OS=Paracoccus denitrificans (strain Pd 1222) GN=nuoD PE=1 SV=1 | 1 | 86 | 2.0E-22 |
sp|P29916|NQO4_PARDE | NADH-quinone oxidoreductase subunit 4 OS=Paracoccus denitrificans GN=nqo4 PE=1 SV=1 | 1 | 86 | 3.0E-22 |
sp|B0ULK7|NUOD_METS4 | NADH-quinone oxidoreductase subunit D OS=Methylobacterium sp. (strain 4-46) GN=nuoD PE=3 SV=1 | 1 | 86 | 3.0E-22 |
sp|A8I3Z3|NUOD_AZOC5 | NADH-quinone oxidoreductase subunit D OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=nuoD PE=3 SV=1 | 1 | 86 | 3.0E-22 |
sp|Q89KI9|NUOD_BRADU | NADH-quinone oxidoreductase subunit D OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=nuoD PE=3 SV=1 | 1 | 86 | 4.0E-22 |
sp|A8LIT9|NUOD_DINSH | NADH-quinone oxidoreductase subunit D OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=nuoD PE=3 SV=1 | 1 | 86 | 5.0E-22 |
sp|Q5PAR3|NUOD_ANAMM | NADH-quinone oxidoreductase subunit D OS=Anaplasma marginale (strain St. Maries) GN=nuoD PE=3 SV=1 | 1 | 86 | 5.0E-22 |
sp|Q3J3F8|NUOD_RHOS4 | NADH-quinone oxidoreductase subunit D OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=nuoD PE=3 SV=1 | 1 | 86 | 5.0E-22 |
sp|A3PIX1|NUOD_RHOS1 | NADH-quinone oxidoreductase subunit D OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=nuoD PE=3 SV=1 | 1 | 86 | 5.0E-22 |
sp|A7HY46|NUOD_PARL1 | NADH-quinone oxidoreductase subunit D OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=nuoD PE=3 SV=1 | 1 | 86 | 5.0E-22 |
sp|Q9A6X4|NUOD_CAUCR | NADH-quinone oxidoreductase subunit D OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=nuoD PE=3 SV=1 | 1 | 86 | 8.0E-22 |
sp|Q98KQ8|NUOD_RHILO | NADH-quinone oxidoreductase subunit D OS=Rhizobium loti (strain MAFF303099) GN=nuoD PE=3 SV=1 | 1 | 86 | 8.0E-22 |
sp|Q5LPR7|NUOD_RUEPO | NADH-quinone oxidoreductase subunit D OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=nuoD PE=3 SV=1 | 1 | 86 | 9.0E-22 |
sp|Q135X7|NUOD_RHOPS | NADH-quinone oxidoreductase subunit D OS=Rhodopseudomonas palustris (strain BisB5) GN=nuoD PE=3 SV=1 | 1 | 86 | 1.0E-21 |
sp|A4WU31|NUOD_RHOS5 | NADH-quinone oxidoreductase subunit D OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=nuoD PE=3 SV=1 | 1 | 86 | 1.0E-21 |
sp|Q2RU37|NUOD_RHORT | NADH-quinone oxidoreductase subunit D OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=nuoD PE=3 SV=1 | 1 | 86 | 1.0E-21 |
sp|Q11JK3|NUOD_CHESB | NADH-quinone oxidoreductase subunit D OS=Chelativorans sp. (strain BNC1) GN=nuoD PE=3 SV=1 | 1 | 86 | 1.0E-21 |
sp|Q3SRE6|NUOD_NITWN | NADH-quinone oxidoreductase subunit D OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=nuoD PE=3 SV=1 | 1 | 86 | 3.0E-21 |
sp|B6JGW3|NUOD_OLICO | NADH-quinone oxidoreductase subunit D OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=nuoD PE=3 SV=1 | 1 | 86 | 3.0E-21 |
sp|B4RCM6|NUOD_PHEZH | NADH-quinone oxidoreductase subunit D OS=Phenylobacterium zucineum (strain HLK1) GN=nuoD PE=3 SV=1 | 1 | 86 | 3.0E-21 |
sp|A9CJA9|NUOD_AGRFC | NADH-quinone oxidoreductase subunit D OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=nuoD PE=3 SV=1 | 1 | 86 | 4.0E-21 |
sp|B3Q7N3|NUOD_RHOPT | NADH-quinone oxidoreductase subunit D OS=Rhodopseudomonas palustris (strain TIE-1) GN=nuoD PE=3 SV=1 | 1 | 86 | 6.0E-21 |
sp|Q6N5M5|NUOD_RHOPA | NADH-quinone oxidoreductase subunit D OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=nuoD PE=3 SV=1 | 1 | 86 | 6.0E-21 |
sp|Q1GIN9|NUOD_RUEST | NADH-quinone oxidoreductase subunit D OS=Ruegeria sp. (strain TM1040) GN=nuoD PE=3 SV=1 | 1 | 86 | 1.0E-20 |
sp|Q28T72|NUOD_JANSC | NADH-quinone oxidoreductase subunit D OS=Jannaschia sp. (strain CCS1) GN=nuoD PE=3 SV=1 | 1 | 86 | 1.0E-20 |
sp|Q2K9T1|NUOD1_RHIEC | NADH-quinone oxidoreductase subunit D 1 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=nuoD1 PE=3 SV=1 | 1 | 86 | 2.0E-20 |
sp|B6ISX8|NUOD_RHOCS | NADH-quinone oxidoreductase subunit D OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=nuoD PE=3 SV=1 | 1 | 87 | 2.0E-20 |
sp|Q1QL87|NUOD2_NITHX | NADH-quinone oxidoreductase subunit D 2 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=nuoD2 PE=3 SV=1 | 1 | 86 | 2.0E-20 |
sp|Q1MIL2|NUOD_RHIL3 | NADH-quinone oxidoreductase subunit D OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=nuoD PE=3 SV=1 | 1 | 86 | 2.0E-20 |
sp|B3PW00|NUOD1_RHIE6 | NADH-quinone oxidoreductase subunit D 1 OS=Rhizobium etli (strain CIAT 652) GN=nuoD1 PE=3 SV=1 | 1 | 86 | 3.0E-20 |
sp|B1ZA43|NUOD_METPB | NADH-quinone oxidoreductase subunit D OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=nuoD PE=3 SV=1 | 1 | 86 | 3.0E-20 |
sp|B5ZYL5|NUOD_RHILW | NADH-quinone oxidoreductase subunit D OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=nuoD PE=3 SV=1 | 1 | 86 | 3.0E-20 |
sp|A9W1N0|NUOD_METEP | NADH-quinone oxidoreductase subunit D OS=Methylobacterium extorquens (strain PA1) GN=nuoD PE=3 SV=1 | 1 | 86 | 4.0E-20 |
sp|B2ILG7|NUOD2_BEII9 | NADH-quinone oxidoreductase subunit D 2 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=nuoD2 PE=3 SV=1 | 1 | 86 | 7.0E-20 |
sp|B1LUN4|NUOD_METRJ | NADH-quinone oxidoreductase subunit D OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=nuoD PE=3 SV=1 | 1 | 86 | 1.0E-19 |
sp|Q0BSK5|NUOD_GRABC | NADH-quinone oxidoreductase subunit D OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=nuoD PE=3 SV=1 | 1 | 86 | 2.0E-19 |
sp|Q8G1B4|NUOD_BRUSU | NADH-quinone oxidoreductase subunit D OS=Brucella suis biovar 1 (strain 1330) GN=nuoD PE=3 SV=1 | 1 | 86 | 2.0E-19 |
sp|A6X1N0|NUOD_OCHA4 | NADH-quinone oxidoreductase subunit D OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=nuoD PE=3 SV=1 | 1 | 86 | 2.0E-19 |
sp|B0CLD2|NUOD_BRUSI | NADH-quinone oxidoreductase subunit D OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=nuoD PE=3 SV=1 | 1 | 86 | 3.0E-19 |
sp|A5VPY6|NUOD_BRUO2 | NADH-quinone oxidoreductase subunit D OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=nuoD PE=3 SV=1 | 1 | 86 | 3.0E-19 |
sp|Q8YGK3|NUOD_BRUME | NADH-quinone oxidoreductase subunit D OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=nuoD PE=3 SV=1 | 1 | 86 | 3.0E-19 |
sp|A9MAI2|NUOD_BRUC2 | NADH-quinone oxidoreductase subunit D OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=nuoD PE=3 SV=1 | 1 | 86 | 3.0E-19 |
sp|Q57DU8|NUOD_BRUAB | NADH-quinone oxidoreductase subunit D OS=Brucella abortus biovar 1 (strain 9-941) GN=nuoD PE=3 SV=1 | 1 | 86 | 3.0E-19 |
sp|Q2YNG0|NUOD_BRUA2 | NADH-quinone oxidoreductase subunit D OS=Brucella abortus (strain 2308) GN=nuoD PE=3 SV=1 | 1 | 86 | 3.0E-19 |
sp|B2S546|NUOD_BRUA1 | NADH-quinone oxidoreductase subunit D OS=Brucella abortus (strain S19) GN=nuoD PE=3 SV=1 | 1 | 86 | 3.0E-19 |
sp|B4SJH6|NUOD1_STRM5 | NADH-quinone oxidoreductase subunit D 1 OS=Stenotrophomonas maltophilia (strain R551-3) GN=nuoD1 PE=3 SV=1 | 1 | 86 | 3.0E-19 |
sp|Q1QP34|NUOD1_NITHX | NADH-quinone oxidoreductase subunit D 1 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=nuoD1 PE=3 SV=1 | 1 | 86 | 6.0E-19 |
sp|O07310|NUOD_RHOCA | NADH-quinone oxidoreductase subunit D OS=Rhodobacter capsulatus GN=nuoD PE=3 SV=2 | 1 | 86 | 2.0E-18 |
sp|A0LDS4|NUOD_MAGMM | NADH-quinone oxidoreductase subunit D OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=nuoD PE=3 SV=1 | 1 | 86 | 2.0E-18 |
sp|B2IHW4|NUOD1_BEII9 | NADH-quinone oxidoreductase subunit D 1 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=nuoD1 PE=3 SV=1 | 1 | 86 | 2.0E-18 |
sp|A1VM63|NUOD_POLNA | NADH-quinone oxidoreductase subunit D OS=Polaromonas naphthalenivorans (strain CJ2) GN=nuoD PE=3 SV=1 | 2 | 86 | 2.0E-18 |
sp|Q3J831|NUOD_NITOC | NADH-quinone oxidoreductase subunit D OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=nuoD PE=3 SV=1 | 1 | 86 | 5.0E-18 |
sp|B2FNX6|NUOD_STRMK | NADH-quinone oxidoreductase subunit D OS=Stenotrophomonas maltophilia (strain K279a) GN=nuoD PE=3 SV=1 | 1 | 86 | 6.0E-18 |
sp|Q5MZI2|NDHH_SYNP6 | NAD(P)H-quinone oxidoreductase subunit H OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=ndhH PE=3 SV=1 | 11 | 88 | 6.0E-18 |
sp|Q31ME6|NDHH_SYNE7 | NAD(P)H-quinone oxidoreductase subunit H OS=Synechococcus elongatus (strain PCC 7942) GN=ndhH PE=3 SV=1 | 11 | 88 | 6.0E-18 |
sp|B4SQT3|NUOD2_STRM5 | NADH-quinone oxidoreductase subunit D 2 OS=Stenotrophomonas maltophilia (strain R551-3) GN=nuoD2 PE=3 SV=1 | 1 | 86 | 7.0E-18 |
sp|Q83BQ8|NUOD_COXBU | NADH-quinone oxidoreductase subunit D OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=nuoD PE=3 SV=1 | 1 | 86 | 7.0E-18 |
sp|A9N8X0|NUOD_COXBR | NADH-quinone oxidoreductase subunit D OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=nuoD PE=3 SV=1 | 1 | 86 | 7.0E-18 |
sp|A7IPA4|NUOD_XANP2 | NADH-quinone oxidoreductase subunit D OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=nuoD PE=3 SV=1 | 1 | 86 | 7.0E-18 |
sp|A5GWA1|NDHH_SYNR3 | NAD(P)H-quinone oxidoreductase subunit H OS=Synechococcus sp. (strain RCC307) GN=ndhH PE=3 SV=1 | 11 | 88 | 7.0E-18 |
sp|Q3SJQ4|NUOD_THIDA | NADH-quinone oxidoreductase subunit D OS=Thiobacillus denitrificans (strain ATCC 25259) GN=nuoD PE=3 SV=1 | 1 | 86 | 8.0E-18 |
sp|A2SFM9|NUOD_METPP | NADH-quinone oxidoreductase subunit D OS=Methylibium petroleiphilum (strain PM1) GN=nuoD PE=3 SV=1 | 2 | 86 | 8.0E-18 |
sp|A9KBK7|NUOD_COXBN | NADH-quinone oxidoreductase subunit D OS=Coxiella burnetii (strain Dugway 5J108-111) GN=nuoD PE=3 SV=3 | 1 | 86 | 8.0E-18 |
sp|B6IZ48|NUOD_COXB2 | NADH-quinone oxidoreductase subunit D OS=Coxiella burnetii (strain CbuG_Q212) GN=nuoD PE=3 SV=1 | 1 | 86 | 8.0E-18 |
sp|B6J697|NUOD_COXB1 | NADH-quinone oxidoreductase subunit D OS=Coxiella burnetii (strain CbuK_Q154) GN=nuoD PE=3 SV=1 | 1 | 86 | 8.0E-18 |
sp|Q21YC4|NUOD_RHOFT | NADH-quinone oxidoreductase subunit D OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=nuoD PE=3 SV=1 | 1 | 86 | 9.0E-18 |
sp|A1K5B1|NUOD_AZOSB | NADH-quinone oxidoreductase subunit D OS=Azoarcus sp. (strain BH72) GN=nuoD PE=3 SV=1 | 1 | 86 | 1.0E-17 |
sp|Q7NZH8|NUOD_CHRVO | NADH-quinone oxidoreductase subunit D OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=nuoD PE=3 SV=1 | 1 | 86 | 1.0E-17 |
sp|A5FX11|NUOD_ACICJ | NADH-quinone oxidoreductase subunit D OS=Acidiphilium cryptum (strain JF-5) GN=nuoD PE=3 SV=1 | 1 | 86 | 1.0E-17 |
sp|A1WLP1|NUOD_VEREI | NADH-quinone oxidoreductase subunit D OS=Verminephrobacter eiseniae (strain EF01-2) GN=nuoD PE=3 SV=1 | 2 | 86 | 1.0E-17 |
sp|A8G2H8|NDHH_PROM2 | NAD(P)H-quinone oxidoreductase subunit H OS=Prochlorococcus marinus (strain MIT 9215) GN=ndhH PE=3 SV=1 | 11 | 88 | 3.0E-17 |
sp|A3PAP0|NDHH_PROM0 | NAD(P)H-quinone oxidoreductase subunit H OS=Prochlorococcus marinus (strain MIT 9301) GN=ndhH PE=3 SV=1 | 11 | 88 | 3.0E-17 |
sp|B1X4A5|NDHH_PAUCH | NAD(P)H-quinone oxidoreductase subunit H, organellar chromatophore OS=Paulinella chromatophora GN=ndhH PE=3 SV=1 | 11 | 88 | 3.0E-17 |
sp|Q31D09|NDHH_PROM9 | NAD(P)H-quinone oxidoreductase subunit H OS=Prochlorococcus marinus (strain MIT 9312) GN=ndhH PE=3 SV=1 | 11 | 88 | 3.0E-17 |
sp|Q127X5|NUOD_POLSJ | NADH-quinone oxidoreductase subunit D OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=nuoD PE=3 SV=1 | 2 | 86 | 3.0E-17 |
sp|B0TWP7|NUOD_FRAP2 | NADH-quinone oxidoreductase subunit D OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=nuoD PE=3 SV=1 | 4 | 86 | 4.0E-17 |
sp|B1Y830|NUOD_LEPCP | NADH-quinone oxidoreductase subunit D OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=nuoD PE=3 SV=1 | 2 | 86 | 5.0E-17 |
sp|A9M3D9|NUOD_NEIM0 | NADH-quinone oxidoreductase subunit D OS=Neisseria meningitidis serogroup C (strain 053442) GN=nuoD PE=3 SV=1 | 1 | 86 | 6.0E-17 |
sp|A2BNW7|NDHH_PROMS | NAD(P)H-quinone oxidoreductase subunit H OS=Prochlorococcus marinus (strain AS9601) GN=ndhH PE=3 SV=1 | 11 | 88 | 8.0E-17 |
sp|A1W4M5|NUOD_ACISJ | NADH-quinone oxidoreductase subunit D OS=Acidovorax sp. (strain JS42) GN=nuoD PE=3 SV=1 | 2 | 86 | 8.0E-17 |
sp|B5EN68|NUOD_ACIF5 | NADH-quinone oxidoreductase subunit D OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=nuoD PE=3 SV=1 | 1 | 86 | 8.0E-17 |
sp|A5IHW0|NUOD_LEGPC | NADH-quinone oxidoreductase subunit D OS=Legionella pneumophila (strain Corby) GN=nuoD PE=3 SV=1 | 4 | 86 | 9.0E-17 |
sp|Q5X1B0|NUOD_LEGPA | NADH-quinone oxidoreductase subunit D OS=Legionella pneumophila (strain Paris) GN=nuoD PE=3 SV=1 | 4 | 86 | 9.0E-17 |
sp|A9IUP7|NUOD_BART1 | NADH-quinone oxidoreductase subunit D OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=nuoD PE=3 SV=1 | 1 | 87 | 9.0E-17 |
sp|Q5P1E7|NUOD_AROAE | NADH-quinone oxidoreductase subunit D OS=Aromatoleum aromaticum (strain EbN1) GN=nuoD PE=3 SV=1 | 1 | 86 | 1.0E-16 |
sp|A6SY08|NUOD_JANMA | NADH-quinone oxidoreductase subunit D OS=Janthinobacterium sp. (strain Marseille) GN=nuoD PE=3 SV=1 | 1 | 86 | 1.0E-16 |
sp|Q31HF7|NUOD_THICR | NADH-quinone oxidoreductase subunit D OS=Thiomicrospira crunogena (strain XCL-2) GN=nuoD PE=3 SV=1 | 1 | 86 | 1.0E-16 |
sp|Q9PGJ2|NUOD_XYLFA | NADH-quinone oxidoreductase subunit D OS=Xylella fastidiosa (strain 9a5c) GN=nuoD PE=3 SV=1 | 1 | 86 | 1.0E-16 |
sp|Q5WT23|NUOD_LEGPL | NADH-quinone oxidoreductase subunit D OS=Legionella pneumophila (strain Lens) GN=nuoD PE=3 SV=1 | 4 | 86 | 1.0E-16 |
sp|Q5ZRU1|NUOD_LEGPH | NADH-quinone oxidoreductase subunit D OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=nuoD PE=3 SV=2 | 4 | 86 | 1.0E-16 |
sp|Q8M9T5|NDHH_CHAGL | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Chaetosphaeridium globosum GN=ndhH PE=3 SV=1 | 11 | 88 | 1.0E-16 |
sp|Q8KX37|NDHH_SYNP2 | NAD(P)H-quinone oxidoreductase subunit H OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=ndhH PE=3 SV=1 | 11 | 88 | 1.0E-16 |
sp|P27724|NDHH_SYNY3 | NAD(P)H-quinone oxidoreductase subunit H OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ndhH PE=1 SV=3 | 11 | 88 | 2.0E-16 |
sp|A4G641|NUOD_HERAR | NADH-quinone oxidoreductase subunit D OS=Herminiimonas arsenicoxydans GN=nuoD PE=3 SV=1 | 1 | 86 | 2.0E-16 |
sp|B2T2F0|NUOD_BURPP | NADH-quinone oxidoreductase subunit D OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=nuoD PE=3 SV=1 | 1 | 86 | 2.0E-16 |
sp|Q142H0|NUOD_BURXL | NADH-quinone oxidoreductase subunit D OS=Burkholderia xenovorans (strain LB400) GN=nuoD PE=3 SV=1 | 1 | 86 | 2.0E-16 |
sp|Q9K1C0|NUOD_NEIMB | NADH-quinone oxidoreductase subunit D OS=Neisseria meningitidis serogroup B (strain MC58) GN=nuoD PE=3 SV=1 | 1 | 86 | 2.0E-16 |
sp|A1INN7|NUOD_NEIMA | NADH-quinone oxidoreductase subunit D OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=nuoD PE=3 SV=1 | 1 | 86 | 2.0E-16 |
sp|A1KRS5|NUOD_NEIMF | NADH-quinone oxidoreductase subunit D OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=nuoD PE=3 SV=1 | 1 | 86 | 2.0E-16 |
sp|B4RPI1|NUOD_NEIG2 | NADH-quinone oxidoreductase subunit D OS=Neisseria gonorrhoeae (strain NCCP11945) GN=nuoD PE=3 SV=1 | 1 | 86 | 2.0E-16 |
sp|Q5F618|NUOD_NEIG1 | NADH-quinone oxidoreductase subunit D OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=nuoD PE=3 SV=1 | 1 | 86 | 2.0E-16 |
sp|B1JVN8|NUOD_BURCC | NADH-quinone oxidoreductase subunit D OS=Burkholderia cenocepacia (strain MC0-3) GN=nuoD PE=3 SV=1 | 1 | 86 | 3.0E-16 |
sp|B4E5L9|NUOD_BURCJ | NADH-quinone oxidoreductase subunit D OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=nuoD PE=3 SV=1 | 1 | 86 | 3.0E-16 |
sp|A0K920|NUOD_BURCH | NADH-quinone oxidoreductase subunit D OS=Burkholderia cenocepacia (strain HI2424) GN=nuoD PE=3 SV=1 | 1 | 86 | 3.0E-16 |
sp|Q1BV16|NUOD_BURCA | NADH-quinone oxidoreductase subunit D OS=Burkholderia cenocepacia (strain AU 1054) GN=nuoD PE=3 SV=1 | 1 | 86 | 3.0E-16 |
sp|Q2GDJ8|NUOD_NEOSM | NADH-quinone oxidoreductase subunit D OS=Neorickettsia sennetsu (strain Miyayama) GN=nuoD PE=3 SV=1 | 1 | 86 | 3.0E-16 |
sp|B1YTQ4|NUOD_BURA4 | NADH-quinone oxidoreductase subunit D OS=Burkholderia ambifaria (strain MC40-6) GN=nuoD PE=3 SV=1 | 1 | 86 | 3.0E-16 |
sp|A1TLL9|NUOD_ACIAC | NADH-quinone oxidoreductase subunit D OS=Acidovorax citrulli (strain AAC00-1) GN=nuoD PE=3 SV=1 | 2 | 86 | 4.0E-16 |
sp|Q0BDD3|NUOD_BURCM | NADH-quinone oxidoreductase subunit D OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=nuoD PE=3 SV=1 | 1 | 86 | 4.0E-16 |
sp|B0JY10|NDHH_MICAN | NAD(P)H-quinone oxidoreductase subunit H OS=Microcystis aeruginosa (strain NIES-843) GN=ndhH PE=3 SV=1 | 11 | 88 | 4.0E-16 |
sp|Q63VN0|NUOD_BURPS | NADH-quinone oxidoreductase subunit D OS=Burkholderia pseudomallei (strain K96243) GN=nuoD PE=3 SV=1 | 1 | 86 | 4.0E-16 |
sp|A3N7M0|NUOD_BURP6 | NADH-quinone oxidoreductase subunit D OS=Burkholderia pseudomallei (strain 668) GN=nuoD PE=3 SV=1 | 1 | 86 | 4.0E-16 |
sp|Q3JUA6|NUOD_BURP1 | NADH-quinone oxidoreductase subunit D OS=Burkholderia pseudomallei (strain 1710b) GN=nuoD PE=3 SV=1 | 1 | 86 | 4.0E-16 |
sp|A3NTA9|NUOD_BURP0 | NADH-quinone oxidoreductase subunit D OS=Burkholderia pseudomallei (strain 1106a) GN=nuoD PE=3 SV=1 | 1 | 86 | 4.0E-16 |
sp|A1V2L9|NUOD_BURMS | NADH-quinone oxidoreductase subunit D OS=Burkholderia mallei (strain SAVP1) GN=nuoD PE=3 SV=1 | 1 | 86 | 4.0E-16 |
sp|Q62IN8|NUOD_BURMA | NADH-quinone oxidoreductase subunit D OS=Burkholderia mallei (strain ATCC 23344) GN=nuoD PE=3 SV=1 | 1 | 86 | 4.0E-16 |
sp|A2S456|NUOD_BURM9 | NADH-quinone oxidoreductase subunit D OS=Burkholderia mallei (strain NCTC 10229) GN=nuoD PE=3 SV=1 | 1 | 86 | 4.0E-16 |
sp|A3MIA4|NUOD_BURM7 | NADH-quinone oxidoreductase subunit D OS=Burkholderia mallei (strain NCTC 10247) GN=nuoD PE=3 SV=1 | 1 | 86 | 4.0E-16 |
sp|Q7V3B0|NDHH_PROMP | NAD(P)H-quinone oxidoreductase subunit H OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=ndhH PE=3 SV=1 | 11 | 88 | 4.0E-16 |
sp|A9AFZ0|NUOD_BURM1 | NADH-quinone oxidoreductase subunit D OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=nuoD PE=3 SV=1 | 1 | 86 | 4.0E-16 |
sp|Q0BK54|NUOD_FRATO | NADH-quinone oxidoreductase subunit D OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=nuoD PE=3 SV=1 | 4 | 86 | 4.0E-16 |
sp|Q2A1F3|NUOD_FRATH | NADH-quinone oxidoreductase subunit D OS=Francisella tularensis subsp. holarctica (strain LVS) GN=nuoD PE=3 SV=1 | 4 | 86 | 4.0E-16 |
sp|A7NEK7|NUOD_FRATF | NADH-quinone oxidoreductase subunit D OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=nuoD PE=3 SV=1 | 4 | 86 | 4.0E-16 |
sp|Q2SZN2|NUOD_BURTA | NADH-quinone oxidoreductase subunit D OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=nuoD PE=3 SV=1 | 1 | 86 | 4.0E-16 |
sp|A4JGC7|NUOD_BURVG | NADH-quinone oxidoreductase subunit D OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=nuoD PE=3 SV=1 | 1 | 86 | 4.0E-16 |
sp|A4IVZ5|NUOD_FRATW | NADH-quinone oxidoreductase subunit D OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=nuoD PE=3 SV=1 | 4 | 86 | 4.0E-16 |
sp|B2SEV2|NUOD_FRATM | NADH-quinone oxidoreductase subunit D OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=nuoD PE=3 SV=1 | 4 | 86 | 4.0E-16 |
sp|Q5NIN2|NUOD_FRATT | NADH-quinone oxidoreductase subunit D OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=nuoD PE=3 SV=1 | 4 | 86 | 5.0E-16 |
sp|Q14K35|NUOD_FRAT1 | NADH-quinone oxidoreductase subunit D OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=nuoD PE=3 SV=1 | 4 | 86 | 5.0E-16 |
sp|A0Q8G9|NUOD_FRATN | NADH-quinone oxidoreductase subunit D OS=Francisella tularensis subsp. novicida (strain U112) GN=nuoD PE=3 SV=1 | 4 | 86 | 5.0E-16 |
sp|A9BD33|NDHH_PROM4 | NAD(P)H-quinone oxidoreductase subunit H OS=Prochlorococcus marinus (strain MIT 9211) GN=ndhH PE=3 SV=1 | 11 | 88 | 5.0E-16 |
sp|Q1GZL2|NUOD_METFK | NADH-quinone oxidoreductase subunit D OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=nuoD PE=3 SV=1 | 4 | 86 | 5.0E-16 |
sp|A2BUE9|NDHH_PROM5 | NAD(P)H-quinone oxidoreductase subunit H OS=Prochlorococcus marinus (strain MIT 9515) GN=ndhH PE=3 SV=1 | 11 | 88 | 5.0E-16 |
sp|A2C001|NDHH_PROM1 | NAD(P)H-quinone oxidoreductase subunit H OS=Prochlorococcus marinus (strain NATL1A) GN=ndhH PE=3 SV=1 | 11 | 88 | 5.0E-16 |
sp|Q46HK0|NDHH_PROMT | NAD(P)H-quinone oxidoreductase subunit H OS=Prochlorococcus marinus (strain NATL2A) GN=ndhH PE=3 SV=1 | 11 | 88 | 5.0E-16 |
sp|Q5HSL5|NUOD_CAMJR | NADH-quinone oxidoreductase subunit D OS=Campylobacter jejuni (strain RM1221) GN=nuoD PE=3 SV=1 | 8 | 86 | 5.0E-16 |
sp|A1W1H5|NUOD_CAMJJ | NADH-quinone oxidoreductase subunit D OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=nuoD PE=3 SV=1 | 8 | 86 | 5.0E-16 |
sp|Q9PM99|NUOD_CAMJE | NADH-quinone oxidoreductase subunit D OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=nuoD PE=3 SV=1 | 8 | 86 | 5.0E-16 |
sp|B1XUK1|NUOD_POLNS | NADH-quinone oxidoreductase subunit D OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=nuoD PE=3 SV=1 | 2 | 86 | 6.0E-16 |
sp|Q87EQ2|NUOD_XYLFT | NADH-quinone oxidoreductase subunit D OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=nuoD PE=3 SV=1 | 1 | 86 | 7.0E-16 |
sp|B2I787|NUOD_XYLF2 | NADH-quinone oxidoreductase subunit D OS=Xylella fastidiosa (strain M23) GN=nuoD PE=3 SV=1 | 1 | 86 | 7.0E-16 |
sp|B0U1W8|NUOD_XYLFM | NADH-quinone oxidoreductase subunit D OS=Xylella fastidiosa (strain M12) GN=nuoD PE=3 SV=1 | 1 | 86 | 8.0E-16 |
sp|A5GP75|NDHH_SYNPW | NAD(P)H-quinone oxidoreductase subunit H OS=Synechococcus sp. (strain WH7803) GN=ndhH PE=3 SV=1 | 11 | 88 | 8.0E-16 |
sp|A4GYX2|NDHH_POPTR | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Populus trichocarpa GN=ndhH PE=3 SV=1 | 11 | 88 | 9.0E-16 |
sp|Q14FA2|NDHH_POPAL | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Populus alba GN=ndhH PE=3 SV=1 | 11 | 88 | 9.0E-16 |
sp|Q7VZQ2|NUOD_BORPE | NADH-quinone oxidoreductase subunit D OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=nuoD PE=3 SV=1 | 1 | 86 | 9.0E-16 |
sp|B2U7Q8|NUOD_RALPJ | NADH-quinone oxidoreductase subunit D OS=Ralstonia pickettii (strain 12J) GN=nuoD PE=3 SV=1 | 2 | 86 | 9.0E-16 |
sp|Q0A778|NUOD_ALKEH | NADH-quinone oxidoreductase subunit D OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=nuoD PE=3 SV=1 | 1 | 86 | 9.0E-16 |
sp|A7H5S8|NUOD_CAMJD | NADH-quinone oxidoreductase subunit D OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=nuoD PE=3 SV=1 | 8 | 86 | 9.0E-16 |
sp|A8FNN4|NUOD_CAMJ8 | NADH-quinone oxidoreductase subunit D OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=nuoD PE=3 SV=1 | 8 | 86 | 9.0E-16 |
sp|A9WFB4|NUOD2_CHLAA | NADH-quinone oxidoreductase subunit D 2 OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=nuoD2 PE=3 SV=1 | 1 | 87 | 9.0E-16 |
sp|A9II07|NUOD_BORPD | NADH-quinone oxidoreductase subunit D OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=nuoD PE=3 SV=1 | 1 | 88 | 1.0E-15 |
sp|Q0I6T6|NDHH_SYNS3 | NAD(P)H-quinone oxidoreductase subunit H OS=Synechococcus sp. (strain CC9311) GN=ndhH PE=3 SV=1 | 11 | 88 | 1.0E-15 |
sp|Q2YA24|NUOD_NITMU | NADH-quinone oxidoreductase subunit D OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=nuoD PE=3 SV=1 | 1 | 86 | 1.0E-15 |
sp|Q10VG2|NDHH_TRIEI | NAD(P)H-quinone oxidoreductase subunit H OS=Trichodesmium erythraeum (strain IMS101) GN=ndhH PE=3 SV=1 | 11 | 88 | 1.0E-15 |
sp|B5YKI5|NUOD1_THEYD | NADH-quinone oxidoreductase subunit D 1 OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=nuoD1 PE=3 SV=1 | 1 | 86 | 1.0E-15 |
sp|A9BNB1|NUOD_DELAS | NADH-quinone oxidoreductase subunit D OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=nuoD PE=3 SV=1 | 1 | 86 | 1.0E-15 |
sp|Q9TKV6|NDHH_NEPOL | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Nephroselmis olivacea GN=ndhH PE=3 SV=1 | 11 | 90 | 1.0E-15 |
sp|Q39EE8|NUOD_BURL3 | NADH-quinone oxidoreductase subunit D OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=nuoD PE=3 SV=1 | 1 | 86 | 1.0E-15 |
sp|Q0G9Q6|NDHH_DAUCA | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Daucus carota GN=ndhH PE=3 SV=1 | 11 | 93 | 1.0E-15 |
sp|B2JDM5|NUOD_BURP8 | NADH-quinone oxidoreductase subunit D OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=nuoD PE=3 SV=1 | 1 | 86 | 1.0E-15 |
sp|A6H5P8|NDHH_CYCTA | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Cycas taitungensis GN=ndhH PE=3 SV=1 | 11 | 88 | 1.0E-15 |
sp|Q6G391|NUOD_BARHE | NADH-quinone oxidoreductase subunit D OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=nuoD PE=3 SV=1 | 1 | 86 | 2.0E-15 |
sp|Q7VE17|NDHH_PROMA | NAD(P)H-quinone oxidoreductase subunit H OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=ndhH PE=3 SV=1 | 11 | 88 | 2.0E-15 |
sp|B5EFG0|NUOD_GEOBB | NADH-quinone oxidoreductase subunit D OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=nuoD PE=3 SV=1 | 1 | 91 | 2.0E-15 |
sp|Q85UU0|NDHH_ANTFO | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Anthoceros formosae GN=ndhH PE=2 SV=1 | 11 | 88 | 2.0E-15 |
sp|A6MMQ7|NDHH_DIOEL | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Dioscorea elephantipes GN=ndhH PE=3 SV=1 | 11 | 88 | 2.0E-15 |
sp|B1VKJ0|NDHH_CRYJA | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Cryptomeria japonica GN=ndhH PE=3 SV=1 | 11 | 88 | 2.0E-15 |
sp|B3R3X0|NUOD_CUPTR | NADH-quinone oxidoreductase subunit D OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=nuoD PE=3 SV=1 | 2 | 86 | 2.0E-15 |
sp|B2J184|NDHH_NOSP7 | NAD(P)H-quinone oxidoreductase subunit H OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=ndhH PE=3 SV=1 | 11 | 88 | 2.0E-15 |
sp|Q2KV09|NUOD_BORA1 | NADH-quinone oxidoreductase subunit D OS=Bordetella avium (strain 197N) GN=nuoD PE=3 SV=1 | 1 | 86 | 2.0E-15 |
sp|A9L9F3|NDHH_LEMMI | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Lemna minor GN=ndhH PE=3 SV=1 | 11 | 88 | 2.0E-15 |
sp|Q473U0|NUOD_CUPPJ | NADH-quinone oxidoreductase subunit D OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=nuoD PE=3 SV=1 | 2 | 86 | 2.0E-15 |
sp|Q1LPW0|NUOD_CUPMC | NADH-quinone oxidoreductase subunit D OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=nuoD PE=3 SV=1 | 2 | 86 | 2.0E-15 |
sp|Q68RV0|NDHH_PANGI | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Panax ginseng GN=ndhH PE=3 SV=1 | 11 | 93 | 3.0E-15 |
sp|Q7U3X8|NDHH_SYNPX | NAD(P)H-quinone oxidoreductase subunit H OS=Synechococcus sp. (strain WH8102) GN=ndhH PE=3 SV=1 | 11 | 88 | 3.0E-15 |
sp|Q3M880|NDHH_ANAVT | NAD(P)H-quinone oxidoreductase subunit H OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=ndhH PE=3 SV=1 | 11 | 93 | 3.0E-15 |
sp|A9B4Z7|NUOD1_HERA2 | NADH-quinone oxidoreductase subunit D 1 OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=nuoD1 PE=3 SV=1 | 1 | 87 | 4.0E-15 |
sp|A1USX0|NUOD_BARBK | NADH-quinone oxidoreductase subunit D OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=nuoD PE=3 SV=1 | 1 | 86 | 4.0E-15 |
sp|Q7W5B0|NUOD_BORPA | NADH-quinone oxidoreductase subunit D OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=nuoD PE=3 SV=1 | 1 | 86 | 4.0E-15 |
sp|Q7WCU2|NUOD_BORBR | NADH-quinone oxidoreductase subunit D OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=nuoD PE=3 SV=1 | 1 | 86 | 4.0E-15 |
sp|Q6FZY8|NUOD_BARQU | NADH-quinone oxidoreductase subunit D OS=Bartonella quintana (strain Toulouse) GN=nuoD PE=3 SV=1 | 1 | 87 | 4.0E-15 |
sp|Q8YRT8|NDHH_NOSS1 | NAD(P)H-quinone oxidoreductase subunit H OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=ndhH PE=3 SV=1 | 11 | 88 | 5.0E-15 |
sp|A7Y3K5|NDHH_IPOPU | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Ipomoea purpurea GN=ndhH PE=3 SV=1 | 11 | 88 | 5.0E-15 |
sp|B3QP55|NUOD_CHLP8 | NADH-quinone oxidoreductase subunit D OS=Chlorobaculum parvum (strain NCIB 8327) GN=nuoD PE=3 SV=1 | 1 | 104 | 5.0E-15 |
sp|Q4VZL2|NDHH_CUCSA | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Cucumis sativus GN=ndhH PE=3 SV=1 | 11 | 90 | 6.0E-15 |
sp|Q3AVZ9|NDHH_SYNS9 | NAD(P)H-quinone oxidoreductase subunit H OS=Synechococcus sp. (strain CC9902) GN=ndhH PE=3 SV=1 | 11 | 88 | 6.0E-15 |
sp|B5YL34|NUOD2_THEYD | NADH-quinone oxidoreductase subunit D 2 OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=nuoD2 PE=3 SV=1 | 1 | 106 | 6.0E-15 |
sp|A2CD94|NDHH_PROM3 | NAD(P)H-quinone oxidoreductase subunit H OS=Prochlorococcus marinus (strain MIT 9303) GN=ndhH PE=3 SV=1 | 11 | 88 | 7.0E-15 |
sp|Q7TUL1|NDHH_PROMM | NAD(P)H-quinone oxidoreductase subunit H OS=Prochlorococcus marinus (strain MIT 9313) GN=ndhH PE=3 SV=1 | 11 | 88 | 7.0E-15 |
sp|Q3AGW8|NDHH_SYNSC | NAD(P)H-quinone oxidoreductase subunit H OS=Synechococcus sp. (strain CC9605) GN=ndhH PE=3 SV=1 | 11 | 88 | 8.0E-15 |
sp|A5G9B6|NUOD_GEOUR | NADH-quinone oxidoreductase subunit D OS=Geobacter uraniireducens (strain Rf4) GN=nuoD PE=3 SV=1 | 1 | 86 | 9.0E-15 |
sp|P56753|NDHH_ARATH | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Arabidopsis thaliana GN=ndhH PE=1 SV=1 | 11 | 93 | 1.0E-14 |
sp|A7HZV1|NUOD_CAMHC | NADH-quinone oxidoreductase subunit D OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=nuoD PE=3 SV=1 | 1 | 86 | 1.0E-14 |
sp|Q2JWB1|NDHH_SYNJA | NAD(P)H-quinone oxidoreductase subunit H OS=Synechococcus sp. (strain JA-3-3Ab) GN=ndhH PE=3 SV=1 | 1 | 88 | 1.0E-14 |
sp|A4SXQ0|NUOD_POLSQ | NADH-quinone oxidoreductase subunit D OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=nuoD PE=3 SV=1 | 2 | 86 | 1.0E-14 |
sp|P12131|NDHH_MARPO | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Marchantia polymorpha GN=ndhH PE=3 SV=1 | 11 | 88 | 1.0E-14 |
sp|B1NWK5|NDHH_MANES | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Manihot esculenta GN=ndhH PE=3 SV=1 | 11 | 88 | 1.0E-14 |
sp|Q0KCS7|NUOD_CUPNH | NADH-quinone oxidoreductase subunit D OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=nuoD PE=3 SV=1 | 2 | 86 | 1.0E-14 |
sp|A4QJQ6|NDHH_AETGR | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Aethionema grandiflorum GN=ndhH PE=3 SV=1 | 11 | 90 | 1.0E-14 |
sp|A4QKG3|NDHH_BARVE | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Barbarea verna GN=ndhH PE=3 SV=1 | 11 | 93 | 1.0E-14 |
sp|A4J657|NUOD_DESRM | NADH-quinone oxidoreductase subunit D OS=Desulfotomaculum reducens (strain MI-1) GN=nuoD PE=3 SV=1 | 1 | 88 | 1.0E-14 |
sp|B8R4B1|NDHH_TRISU | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Trifolium subterraneum GN=ndhH PE=3 SV=1 | 11 | 88 | 1.0E-14 |
sp|A4QL77|NDHH_DRANE | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Draba nemorosa GN=ndhH PE=3 SV=1 | 11 | 93 | 1.0E-14 |
sp|Q6YXP7|NDHH_PHYPA | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Physcomitrella patens subsp. patens GN=ndhH PE=3 SV=1 | 11 | 88 | 1.0E-14 |
sp|Q8WHX3|NDHH_PSINU | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Psilotum nudum GN=ndhH PE=3 SV=1 | 11 | 88 | 1.0E-14 |
sp|A4QKZ0|NDHH_CRUWA | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Crucihimalaya wallichii GN=ndhH PE=3 SV=1 | 11 | 93 | 2.0E-14 |
sp|A4QJY8|NDHH_OLIPU | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Olimarabidopsis pumila GN=ndhH PE=3 SV=1 | 11 | 93 | 2.0E-14 |
sp|A4QLG5|NDHH_LEPVR | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Lepidium virginicum GN=ndhH PE=3 SV=1 | 11 | 93 | 2.0E-14 |
sp|A4QLZ1|NDHH_NASOF | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Nasturtium officinale GN=ndhH PE=3 SV=1 | 11 | 93 | 2.0E-14 |
sp|A4QKQ1|NDHH_CAPBU | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Capsella bursa-pastoris GN=ndhH PE=3 SV=1 | 11 | 93 | 2.0E-14 |
sp|A4QLQ3|NDHH_LOBMA | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Lobularia maritima GN=ndhH PE=3 SV=1 | 11 | 93 | 2.0E-14 |
sp|A4QK76|NDHH_ARAHI | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Arabis hirsuta GN=ndhH PE=3 SV=1 | 11 | 93 | 2.0E-14 |
sp|Q0ZIW2|NDHH_VITVI | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Vitis vinifera GN=ndhH PE=3 SV=1 | 11 | 88 | 2.0E-14 |
sp|B0Z5I3|NDHH_OENPA | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Oenothera parviflora GN=ndhH PE=3 SV=1 | 11 | 90 | 2.0E-14 |
sp|B0Z4T1|NDHH_OENAR | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Oenothera argillicola GN=ndhH PE=3 SV=1 | 11 | 90 | 2.0E-14 |
sp|A0A391|NDHH_COFAR | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Coffea arabica GN=ndhH PE=3 SV=1 | 11 | 88 | 2.0E-14 |
sp|B0Z599|NDHH_OENGL | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Oenothera glazioviana GN=ndhH PE=3 SV=1 | 11 | 90 | 2.0E-14 |
sp|Q9MTH6|NDHH_OENEH | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Oenothera elata subsp. hookeri GN=ndhH PE=3 SV=1 | 11 | 90 | 2.0E-14 |
sp|B0Z515|NDHH_OENBI | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Oenothera biennis GN=ndhH PE=3 SV=1 | 11 | 90 | 2.0E-14 |
sp|Q2PMN8|NDHH_SOYBN | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Glycine max GN=ndhH PE=3 SV=1 | 11 | 88 | 2.0E-14 |
sp|B3E9W6|NUOD_GEOLS | NADH-quinone oxidoreductase subunit D OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=nuoD PE=3 SV=1 | 1 | 89 | 2.0E-14 |
sp|Q32RK3|NDHH_ZYGCR | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Zygnema circumcarinatum GN=ndhH PE=3 SV=1 | 11 | 90 | 2.0E-14 |
sp|Q0AHJ7|NUOD_NITEC | NADH-quinone oxidoreductase subunit D OS=Nitrosomonas eutropha (strain C91) GN=nuoD PE=3 SV=1 | 1 | 86 | 2.0E-14 |
sp|A8SEG2|NDHH_CERDE | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Ceratophyllum demersum GN=ndhH PE=3 SV=1 | 11 | 93 | 2.0E-14 |
sp|Q06R74|NDHH_JASNU | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Jasminum nudiflorum GN=ndhH PE=3 SV=1 | 11 | 88 | 2.0E-14 |
sp|Q2JN25|NDHH_SYNJB | NAD(P)H-quinone oxidoreductase subunit H OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=ndhH PE=3 SV=1 | 1 | 88 | 2.0E-14 |
sp|Q09FQ4|NDHH_NANDO | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Nandina domestica GN=ndhH PE=3 SV=1 | 11 | 88 | 3.0E-14 |
sp|Q8P7T5|NUOD_XANCP | NADH-quinone oxidoreductase subunit D OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=nuoD PE=3 SV=1 | 1 | 86 | 3.0E-14 |
sp|B0RRA1|NUOD_XANCB | NADH-quinone oxidoreductase subunit D OS=Xanthomonas campestris pv. campestris (strain B100) GN=nuoD PE=3 SV=1 | 1 | 86 | 3.0E-14 |
sp|Q4UWB5|NUOD_XANC8 | NADH-quinone oxidoreductase subunit D OS=Xanthomonas campestris pv. campestris (strain 8004) GN=nuoD PE=3 SV=1 | 1 | 86 | 3.0E-14 |
sp|Q1GTK0|NUOD_SPHAL | NADH-quinone oxidoreductase subunit D OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=nuoD PE=3 SV=2 | 1 | 86 | 3.0E-14 |
sp|A8Z6E5|NUOD_CAMC1 | NADH-quinone oxidoreductase subunit D OS=Campylobacter concisus (strain 13826) GN=nuoD PE=3 SV=1 | 8 | 86 | 3.0E-14 |
sp|Q06FP8|NDHH_PELHO | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Pelargonium hortorum GN=ndhH PE=3 SV=1 | 11 | 91 | 3.0E-14 |
sp|B2LMP2|NDHH_GUIAB | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Guizotia abyssinica GN=ndhH PE=3 SV=1 | 11 | 88 | 3.0E-14 |
sp|Q7YJS8|NDHH_CALFG | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Calycanthus floridus var. glaucus GN=ndhH PE=3 SV=1 | 11 | 88 | 3.0E-14 |
sp|Q1KXQ9|NDHH_HELAN | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Helianthus annuus GN=ndhH PE=3 SV=1 | 11 | 88 | 3.0E-14 |
sp|B1A990|NDHH_CARPA | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Carica papaya GN=ndhH PE=3 SV=1 | 11 | 88 | 3.0E-14 |
sp|P25709|NDHH_MAIZE | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Zea mays GN=ndhH PE=3 SV=1 | 2 | 88 | 3.0E-14 |
sp|A6MMH1|NDHH_CHLSC | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Chloranthus spicatus GN=ndhH PE=3 SV=1 | 11 | 88 | 3.0E-14 |
sp|Q6EVZ4|NDHH_NYMAL | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Nymphaea alba GN=ndhH PE=3 SV=1 | 11 | 93 | 3.0E-14 |
sp|A1XG11|NDHH_NUPAD | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Nuphar advena GN=ndhH PE=3 SV=1 | 11 | 93 | 3.0E-14 |
sp|A2T389|NDHH_ANGEV | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Angiopteris evecta GN=ndhH PE=3 SV=1 | 11 | 88 | 3.0E-14 |
sp|Q09FZ0|NDHH_PLAOC | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Platanus occidentalis GN=ndhH PE=3 SV=1 | 11 | 88 | 3.0E-14 |
sp|B5LMS0|NDHH_CICAR | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Cicer arietinum GN=ndhH PE=3 SV=1 | 11 | 88 | 4.0E-14 |
sp|Q332S1|NDHH_LACSA | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Lactuca sativa GN=ndhH PE=3 SV=1 | 11 | 88 | 4.0E-14 |
sp|Q3ASW5|NUOD_CHLCH | NADH-quinone oxidoreductase subunit D OS=Chlorobium chlorochromatii (strain CaD3) GN=nuoD PE=3 SV=1 | 5 | 104 | 4.0E-14 |
sp|Q8PJ43|NUOD_XANAC | NADH-quinone oxidoreductase subunit D OS=Xanthomonas axonopodis pv. citri (strain 306) GN=nuoD PE=3 SV=1 | 1 | 86 | 5.0E-14 |
sp|Q3BRN2|NUOD_XANC5 | NADH-quinone oxidoreductase subunit D OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=nuoD PE=3 SV=1 | 1 | 86 | 5.0E-14 |
sp|Q1ACE3|NDHH_CHAVU | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Chara vulgaris GN=ndhH PE=3 SV=1 | 11 | 88 | 5.0E-14 |
sp|A6MM93|NDHH_BUXMI | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Buxus microphylla GN=ndhH PE=3 SV=1 | 11 | 88 | 5.0E-14 |
sp|Q70XV8|NDHH_AMBTC | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Amborella trichopoda GN=ndhH PE=3 SV=1 | 11 | 88 | 5.0E-14 |
sp|Q32S01|NDHH_STAPU | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Staurastrum punctulatum GN=ndhH PE=3 SV=1 | 11 | 88 | 6.0E-14 |
sp|Q39QB0|NUOD_GEOMG | NADH-quinone oxidoreductase subunit D OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=nuoD PE=3 SV=1 | 1 | 86 | 6.0E-14 |
sp|Q8KEC0|NUOD_CHLTE | NADH-quinone oxidoreductase subunit D OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=nuoD PE=3 SV=2 | 1 | 104 | 7.0E-14 |
sp|Q47HH3|NUOD_DECAR | NADH-quinone oxidoreductase subunit D OS=Dechloromonas aromatica (strain RCB) GN=nuoD PE=3 SV=1 | 1 | 86 | 7.0E-14 |
sp|P12133|NDHH_TOBAC | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Nicotiana tabacum GN=ndhH PE=3 SV=1 | 11 | 93 | 7.0E-14 |
sp|Q3C1P8|NDHH_NICSY | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Nicotiana sylvestris GN=ndhH PE=3 SV=1 | 11 | 93 | 7.0E-14 |
sp|A1AVR5|NUOD_RUTMC | NADH-quinone oxidoreductase subunit D OS=Ruthia magnifica subsp. Calyptogena magnifica GN=nuoD PE=3 SV=1 | 1 | 86 | 7.0E-14 |
sp|Q67KN9|NUOD2_SYMTH | NADH-quinone oxidoreductase subunit D 2 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=nuoD2 PE=3 SV=1 | 3 | 89 | 8.0E-14 |
sp|A7GW67|NUOD_CAMC5 | NADH-quinone oxidoreductase subunit D OS=Campylobacter curvus (strain 525.92) GN=nuoD PE=3 SV=1 | 8 | 86 | 9.0E-14 |
sp|P56908|NUOD2_RHIME | NADH-quinone oxidoreductase subunit D 2 OS=Rhizobium meliloti (strain 1021) GN=nuoD2 PE=3 SV=2 | 1 | 86 | 9.0E-14 |
sp|B3EI96|NUOD_CHLL2 | NADH-quinone oxidoreductase subunit D OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=nuoD PE=3 SV=1 | 1 | 104 | 9.0E-14 |
sp|A4QJH2|NDHH_AETCO | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Aethionema cordifolium GN=ndhH PE=3 SV=1 | 11 | 90 | 9.0E-14 |
sp|Q8S8U4|NDHH_ATRBE | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Atropa belladonna GN=ndhH PE=3 SV=1 | 11 | 93 | 1.0E-13 |
sp|A1XGT5|NDHH_RANMC | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Ranunculus macranthus GN=ndhH PE=3 SV=1 | 11 | 88 | 1.0E-13 |
sp|Q49KU2|NDHH_EUCGG | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Eucalyptus globulus subsp. globulus GN=ndhH PE=3 SV=1 | 11 | 88 | 1.0E-13 |
sp|Q1IS59|NUOD1_KORVE | NADH-quinone oxidoreductase subunit D 1 OS=Koribacter versatilis (strain Ellin345) GN=nuoD1 PE=3 SV=1 | 1 | 86 | 1.0E-13 |
sp|Q2MI44|NDHH_SOLLC | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Solanum lycopersicum GN=ndhH PE=3 SV=1 | 11 | 93 | 1.0E-13 |
sp|Q9MUL0|NDHH_MESVI | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Mesostigma viride GN=ndhH PE=3 SV=1 | 11 | 88 | 1.0E-13 |
sp|Q2MID1|NDHH_SOLBU | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Solanum bulbocastanum GN=ndhH PE=3 SV=1 | 11 | 93 | 1.0E-13 |
sp|Q2G5Y6|NUOD_NOVAD | NADH-quinone oxidoreductase subunit D OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=nuoD PE=3 SV=1 | 1 | 86 | 1.0E-13 |
sp|Q09MC0|NDHH_CITSI | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Citrus sinensis GN=ndhH PE=3 SV=1 | 11 | 88 | 1.0E-13 |
sp|Q74GA5|NUOD_GEOSL | NADH-quinone oxidoreductase subunit D OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=nuoD PE=3 SV=1 | 1 | 86 | 1.0E-13 |
sp|A4SF45|NUOD_CHLPM | NADH-quinone oxidoreductase subunit D OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=nuoD PE=3 SV=1 | 13 | 104 | 1.0E-13 |
sp|A6MN01|NDHH_ILLOL | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Illicium oligandrum GN=ndhH PE=3 SV=1 | 2 | 88 | 1.0E-13 |
sp|A6UFK4|NUOD2_SINMW | NADH-quinone oxidoreductase subunit D 2 OS=Sinorhizobium medicae (strain WSM419) GN=nuoD2 PE=3 SV=1 | 1 | 86 | 1.0E-13 |
sp|Q5GXT4|NUOD_XANOR | NADH-quinone oxidoreductase subunit D OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=nuoD PE=3 SV=1 | 1 | 86 | 2.0E-13 |
sp|B2SVL6|NUOD_XANOP | NADH-quinone oxidoreductase subunit D OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=nuoD PE=3 SV=1 | 1 | 86 | 2.0E-13 |
sp|Q2P0V8|NUOD_XANOM | NADH-quinone oxidoreductase subunit D OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=nuoD PE=3 SV=1 | 1 | 86 | 2.0E-13 |
sp|Q6ENP1|NDHH_SACOF | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Saccharum officinarum GN=ndhH PE=3 SV=1 | 11 | 88 | 2.0E-13 |
sp|Q6L3D4|NDHH_SACHY | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Saccharum hybrid GN=ndhH PE=3 SV=1 | 11 | 88 | 2.0E-13 |
sp|A1E9Y0|NDHH_SORBI | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Sorghum bicolor GN=ndhH PE=3 SV=1 | 11 | 88 | 2.0E-13 |
sp|Q82TU6|NUOD_NITEU | NADH-quinone oxidoreductase subunit D OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=nuoD PE=3 SV=1 | 1 | 86 | 2.0E-13 |
sp|Q5KUJ8|NUOD_GEOKA | NADH-quinone oxidoreductase subunit D OS=Geobacillus kaustophilus (strain HTA426) GN=nuoD PE=3 SV=1 | 11 | 86 | 3.0E-13 |
sp|B4SBZ0|NUOD_PELPB | NADH-quinone oxidoreductase subunit D OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=nuoD PE=3 SV=1 | 5 | 104 | 3.0E-13 |
sp|Q3A825|NUBCD_PELCD | NADH-quinone oxidoreductase subunit B/C/D OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=nuoBCD PE=3 SV=1 | 11 | 87 | 3.0E-13 |
sp|Q2VEC5|NDHH_SOLTU | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Solanum tuberosum GN=ndhH PE=3 SV=1 | 11 | 93 | 3.0E-13 |
sp|Q0G9G3|NDHH_LIRTU | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Liriodendron tulipifera GN=ndhH PE=3 SV=1 | 11 | 88 | 3.0E-13 |
sp|Q2L953|NDHH_GOSHI | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Gossypium hirsutum GN=ndhH PE=3 SV=1 | 11 | 88 | 3.0E-13 |
sp|A0ZZ91|NDHH_GOSBA | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Gossypium barbadense GN=ndhH PE=3 SV=1 | 11 | 88 | 3.0E-13 |
sp|A4ITI4|NUOD_GEOTN | NADH-quinone oxidoreductase subunit D OS=Geobacillus thermodenitrificans (strain NG80-2) GN=nuoD PE=3 SV=1 | 11 | 86 | 4.0E-13 |
sp|A4GGF2|NDHH_PHAVU | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Phaseolus vulgaris GN=ndhH PE=3 SV=1 | 11 | 88 | 4.0E-13 |
sp|A1EA65|NDHH_AGRST | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Agrostis stolonifera GN=ndhH-A PE=3 SV=1 | 11 | 88 | 4.0E-13 |
sp|P0C337|NDHH_ORYSJ | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Oryza sativa subsp. japonica GN=ndhH PE=3 SV=1 | 11 | 88 | 4.0E-13 |
sp|P0C336|NDHH_ORYSI | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Oryza sativa subsp. indica GN=ndhH PE=3 SV=1 | 11 | 88 | 4.0E-13 |
sp|P0C335|NDHH_ORYSA | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Oryza sativa GN=ndhH PE=3 SV=1 | 11 | 88 | 4.0E-13 |
sp|Q6ENA1|NDHH_ORYNI | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Oryza nivara GN=ndhH PE=3 SV=1 | 11 | 88 | 4.0E-13 |
sp|Q19V59|NDHH_CHLAT | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Chlorokybus atmophyticus GN=ndhH PE=3 SV=2 | 11 | 88 | 4.0E-13 |
sp|O98691|NDHH_HORVU | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Hordeum vulgare GN=ndhH PE=3 SV=1 | 11 | 88 | 5.0E-13 |
sp|A1WXW4|NUOD_HALHL | NADH-quinone oxidoreductase subunit D OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=nuoD PE=3 SV=1 | 1 | 86 | 5.0E-13 |
sp|B0BZ27|NDHH_ACAM1 | NAD(P)H-quinone oxidoreductase subunit H OS=Acaryochloris marina (strain MBIC 11017) GN=ndhH PE=3 SV=1 | 2 | 88 | 5.0E-13 |
sp|Q3V4X8|NDHH_ACOCL | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Acorus calamus GN=ndhH PE=3 SV=2 | 11 | 88 | 5.0E-13 |
sp|A9LYF6|NDHH_ACOAM | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Acorus americanus GN=ndhH PE=3 SV=1 | 11 | 88 | 5.0E-13 |
sp|B2XWJ7|NDHH_FAGEA | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Fagopyrum esculentum subsp. ancestrale GN=ndhH PE=3 SV=1 | 11 | 93 | 5.0E-13 |
sp|A5CXG0|NUOD_VESOH | NADH-quinone oxidoreductase subunit D OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=nuoD PE=3 SV=1 | 1 | 86 | 6.0E-13 |
sp|Q33BW6|NDHH_NICTO | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Nicotiana tomentosiformis GN=ndhH PE=3 SV=1 | 11 | 93 | 6.0E-13 |
sp|A5UZH7|NUOD2_ROSS1 | NADH-quinone oxidoreductase subunit D 2 OS=Roseiflexus sp. (strain RS-1) GN=nuoD2 PE=3 SV=1 | 1 | 87 | 6.0E-13 |
sp|Q09WW2|NDHH_MORIN | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Morus indica GN=ndhH PE=3 SV=1 | 11 | 88 | 7.0E-13 |
sp|Q7NI12|NDHH1_GLOVI | NAD(P)H-quinone oxidoreductase subunit H 1 OS=Gloeobacter violaceus (strain PCC 7421) GN=ndhH1 PE=3 SV=1 | 11 | 88 | 7.0E-13 |
sp|B3EK98|NUOD_CHLPB | NADH-quinone oxidoreductase subunit D OS=Chlorobium phaeobacteroides (strain BS1) GN=nuoD PE=3 SV=1 | 1 | 88 | 1.0E-12 |
sp|Q2K3U2|NUOD2_RHIEC | NADH-quinone oxidoreductase subunit D 2 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=nuoD2 PE=3 SV=1 | 1 | 86 | 1.0E-12 |
sp|B3PY59|NUOD2_RHIE6 | NADH-quinone oxidoreductase subunit D 2 OS=Rhizobium etli (strain CIAT 652) GN=nuoD2 PE=3 SV=1 | 1 | 86 | 1.0E-12 |
sp|A5VAM0|NUOD_SPHWW | NADH-quinone oxidoreductase subunit D OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=nuoD PE=3 SV=1 | 1 | 86 | 1.0E-12 |
sp|B8Y2U9|NDHH_FESAR | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Festuca arundinacea GN=ndhH PE=3 SV=1 | 11 | 88 | 1.0E-12 |
sp|Q3B4W0|NUOD_CHLL7 | NADH-quinone oxidoreductase subunit D OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=nuoD PE=3 SV=1 | 1 | 104 | 2.0E-12 |
sp|A1BF35|NUOD_CHLPD | NADH-quinone oxidoreductase subunit D OS=Chlorobium phaeobacteroides (strain DSM 266) GN=nuoD PE=3 SV=1 | 1 | 104 | 2.0E-12 |
sp|Q95H42|NDHH_WHEAT | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Triticum aestivum GN=ndhH PE=3 SV=1 | 11 | 88 | 2.0E-12 |
sp|A8Y9E3|NDHH_LOLPR | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Lolium perenne GN=ndhH PE=3 SV=1 | 11 | 88 | 3.0E-12 |
sp|Q7VFS5|NUOD_HELHP | NADH-quinone oxidoreductase subunit D OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=nuoD PE=3 SV=1 | 11 | 86 | 3.0E-12 |
sp|B4S754|NUOD_PROA2 | NADH-quinone oxidoreductase subunit D OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=nuoD PE=3 SV=1 | 1 | 104 | 4.0E-12 |
sp|A6QCG0|NUOD_SULNB | NADH-quinone oxidoreductase subunit D OS=Sulfurovum sp. (strain NBC37-1) GN=nuoD PE=3 SV=1 | 8 | 86 | 5.0E-12 |
sp|Q2NA64|NUOD_ERYLH | NADH-quinone oxidoreductase subunit D OS=Erythrobacter litoralis (strain HTCC2594) GN=nuoD PE=3 SV=1 | 1 | 87 | 5.0E-12 |
sp|A9G9T3|NUOD2_SORC5 | NADH-quinone oxidoreductase subunit D 2 OS=Sorangium cellulosum (strain So ce56) GN=nuoD2 PE=3 SV=1 | 2 | 86 | 5.0E-12 |
sp|Q06GU0|NDHH_DRIGR | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Drimys granadensis GN=ndhH PE=3 SV=1 | 11 | 88 | 6.0E-12 |
sp|Q9M3I5|NDHH_SPIOL | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Spinacia oleracea GN=ndhH PE=3 SV=1 | 11 | 88 | 6.0E-12 |
sp|B3DXN7|NUOD_METI4 | NADH-quinone oxidoreductase subunit D OS=Methylacidiphilum infernorum (isolate V4) GN=nuoD PE=3 SV=1 | 8 | 86 | 8.0E-12 |
sp|Q7NI01|NDHH2_GLOVI | NAD(P)H-quinone oxidoreductase subunit H 2 OS=Gloeobacter violaceus (strain PCC 7421) GN=ndhH2 PE=3 SV=1 | 11 | 88 | 9.0E-12 |
sp|A7NIV9|NUOD1_ROSCS | NADH-quinone oxidoreductase subunit D 1 OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=nuoD1 PE=3 SV=1 | 1 | 87 | 1.0E-11 |
sp|P15689|NDUS2_PARTE | NADH-ubiquinone oxidoreductase 49 kDa subunit OS=Paramecium tetraurelia GN=NAD7 PE=3 SV=1 | 1 | 86 | 1.0E-11 |
sp|A6Q1P6|NUOD_NITSB | NADH-quinone oxidoreductase subunit D OS=Nitratiruptor sp. (strain SB155-2) GN=nuoD PE=3 SV=1 | 8 | 86 | 1.0E-11 |
sp|Q7MA48|NUOD_WOLSU | NADH-quinone oxidoreductase subunit D OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=nuoD PE=3 SV=1 | 8 | 86 | 1.0E-11 |
sp|Q85FG9|NDHH_ADICA | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Adiantum capillus-veneris GN=ndhH PE=2 SV=2 | 11 | 88 | 1.0E-11 |
sp|Q01UN9|NUOD2_SOLUE | NADH-quinone oxidoreductase subunit D 2 OS=Solibacter usitatus (strain Ellin6076) GN=nuoD2 PE=3 SV=1 | 1 | 86 | 2.0E-11 |
sp|Q5SCZ3|NDHH_HUPLU | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Huperzia lucidula GN=ndhH PE=3 SV=1 | 11 | 88 | 2.0E-11 |
sp|O67335|NUCD2_AQUAE | NADH-quinone oxidoreductase subunit C/D 2 OS=Aquifex aeolicus (strain VF5) GN=nuoC2 PE=3 SV=1 | 11 | 88 | 2.0E-11 |
sp|Q8DJD9|NDHH_THEEB | NAD(P)H-quinone oxidoreductase subunit H OS=Thermosynechococcus elongatus (strain BP-1) GN=ndhH PE=3 SV=1 | 11 | 88 | 2.0E-11 |
sp|B2UV27|NUOD_HELPS | NADH-quinone oxidoreductase subunit D OS=Helicobacter pylori (strain Shi470) GN=nuoD PE=3 SV=1 | 11 | 86 | 2.0E-11 |
sp|Q02CU0|NUOD1_SOLUE | NADH-quinone oxidoreductase subunit D 1 OS=Solibacter usitatus (strain Ellin6076) GN=nuoD1 PE=3 SV=1 | 11 | 105 | 3.0E-11 |
sp|B3TNA5|NDHH_BRADI | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Brachypodium distachyon GN=ndhH PE=3 SV=1 | 11 | 88 | 3.0E-11 |
sp|Q1IS35|NUOD2_KORVE | NADH-quinone oxidoreductase subunit D 2 OS=Koribacter versatilis (strain Ellin345) GN=nuoD2 PE=3 SV=1 | 1 | 91 | 4.0E-11 |
sp|A7H9U8|NUOD1_ANADF | NADH-quinone oxidoreductase subunit D 1 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=nuoD1 PE=3 SV=1 | 2 | 86 | 4.0E-11 |
sp|Q1CRZ8|NUOD_HELPH | NADH-quinone oxidoreductase subunit D OS=Helicobacter pylori (strain HPAG1) GN=nuoD PE=3 SV=1 | 11 | 86 | 5.0E-11 |
sp|O25853|NUOD_HELPY | NADH-quinone oxidoreductase subunit D OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=nuoD PE=3 SV=1 | 11 | 86 | 6.0E-11 |
sp|Q9ZJW4|NUOD_HELPJ | NADH-quinone oxidoreductase subunit D OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=nuoD PE=3 SV=1 | 11 | 86 | 6.0E-11 |
sp|B5Z8Q8|NUOD_HELPG | NADH-quinone oxidoreductase subunit D OS=Helicobacter pylori (strain G27) GN=nuoD PE=3 SV=1 | 11 | 86 | 6.0E-11 |
sp|B6JNA3|NUOD_HELP2 | NADH-quinone oxidoreductase subunit D OS=Helicobacter pylori (strain P12) GN=nuoD PE=3 SV=1 | 11 | 86 | 6.0E-11 |
sp|Q17Z55|NUOD_HELAH | NADH-quinone oxidoreductase subunit D OS=Helicobacter acinonychis (strain Sheeba) GN=nuoD PE=3 SV=1 | 11 | 86 | 6.0E-11 |
sp|Q746S4|NUBCD_GEOSL | NADH-quinone oxidoreductase subunit B/C/D OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=nuoBCD PE=3 SV=1 | 11 | 87 | 9.0E-11 |
sp|P86250|NDUS2_MESAU | NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial (Fragments) OS=Mesocricetus auratus GN=NDUFS2 PE=1 SV=1 | 2 | 49 | 1.0E-10 |
sp|Q06GL1|NDHH_PIPCE | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Piper cenocladum GN=ndhH PE=3 SV=1 | 11 | 90 | 1.0E-10 |
sp|B1KJV0|NUOCD_SHEWM | NADH-quinone oxidoreductase subunit C/D OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=nuoC PE=3 SV=1 | 5 | 86 | 2.0E-10 |
sp|B2V8J2|NUOCD_SULSY | NADH-quinone oxidoreductase subunit C/D OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=nuoC PE=3 SV=1 | 1 | 93 | 2.0E-10 |
sp|B1ZRT0|NUOD1_OPITP | NADH-quinone oxidoreductase subunit D 1 OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=nuoD1 PE=3 SV=1 | 3 | 87 | 2.0E-10 |
sp|A5FXJ8|NUOCD_ACICJ | NADH-quinone oxidoreductase subunit C/D OS=Acidiphilium cryptum (strain JF-5) GN=nuoC PE=3 SV=1 | 11 | 86 | 2.0E-10 |
sp|A5GCZ4|NUBCD_GEOUR | NADH-quinone oxidoreductase subunit B/C/D OS=Geobacter uraniireducens (strain Rf4) GN=nuoBCD PE=3 SV=1 | 11 | 87 | 2.0E-10 |
sp|A9VS95|NUOD_BACWK | NADH-quinone oxidoreductase subunit D OS=Bacillus weihenstephanensis (strain KBAB4) GN=nuoD PE=3 SV=1 | 11 | 86 | 2.0E-10 |
sp|A6LXQ2|NUOD_CLOB8 | NADH-quinone oxidoreductase subunit D OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=nuoD PE=3 SV=1 | 1 | 86 | 3.0E-10 |
sp|Q1D8S7|NUOD_MYXXD | NADH-quinone oxidoreductase subunit D OS=Myxococcus xanthus (strain DK 1622) GN=nuoD PE=3 SV=1 | 8 | 87 | 3.0E-10 |
sp|Q81K03|NUOD_BACAN | NADH-quinone oxidoreductase subunit D OS=Bacillus anthracis GN=nuoD PE=3 SV=1 | 11 | 86 | 4.0E-10 |
sp|Q6HAY8|NUOD_BACHK | NADH-quinone oxidoreductase subunit D OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=nuoD PE=3 SV=1 | 11 | 86 | 4.0E-10 |
sp|B2ULZ0|NUOD_AKKM8 | NADH-quinone oxidoreductase subunit D OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=nuoD PE=3 SV=1 | 3 | 88 | 4.0E-10 |
sp|A0RL88|NUOD_BACAH | NADH-quinone oxidoreductase subunit D OS=Bacillus thuringiensis (strain Al Hakam) GN=nuoD PE=3 SV=1 | 11 | 86 | 4.0E-10 |
sp|Q814W9|NUOD_BACCR | NADH-quinone oxidoreductase subunit D OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=nuoD PE=3 SV=1 | 11 | 86 | 4.0E-10 |
sp|B3QUS0|NUOD1_CHLT3 | NADH-quinone oxidoreductase subunit D 1 OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=nuoD1 PE=3 SV=1 | 7 | 86 | 7.0E-10 |
sp|O66826|NUCD1_AQUAE | NADH-quinone oxidoreductase subunit C/D 1 OS=Aquifex aeolicus (strain VF5) GN=nuoC1 PE=3 SV=1 | 1 | 86 | 8.0E-10 |
sp|A7GV48|NUOD_BACCN | NADH-quinone oxidoreductase subunit D OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=nuoD PE=3 SV=1 | 11 | 86 | 9.0E-10 |
sp|A8M619|NUOD1_SALAI | NADH-quinone oxidoreductase subunit D 1 OS=Salinispora arenicola (strain CNS-205) GN=nuoD1 PE=3 SV=1 | 1 | 87 | 1.0E-09 |
sp|A7H9V5|NUOD2_ANADF | NADH-quinone oxidoreductase subunit D 2 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=nuoD2 PE=3 SV=1 | 10 | 87 | 1.0E-09 |
sp|B4U8I3|NUOCD_HYDS0 | NADH-quinone oxidoreductase subunit C/D OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=nuoC PE=3 SV=1 | 1 | 88 | 1.0E-09 |
sp|Q9BBN8|NDHH_LOTJA | NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Lotus japonicus GN=ndhH PE=3 SV=1 | 11 | 88 | 1.0E-09 |
sp|Q608X9|NUOCD_METCA | NADH-quinone oxidoreductase subunit C/D OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=nuoC PE=3 SV=1 | 2 | 87 | 1.0E-09 |
sp|Q2S5J0|NUOD_SALRD | NADH-quinone oxidoreductase subunit D OS=Salinibacter ruber (strain DSM 13855 / M31) GN=nuoD PE=3 SV=1 | 7 | 86 | 2.0E-09 |
sp|B4UIA2|NUOD1_ANASK | NADH-quinone oxidoreductase subunit D 1 OS=Anaeromyxobacter sp. (strain K) GN=nuoD1 PE=3 SV=1 | 11 | 86 | 2.0E-09 |
sp|Q2IL16|NUOD2_ANADE | NADH-quinone oxidoreductase subunit D 2 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=nuoD2 PE=3 SV=1 | 11 | 86 | 2.0E-09 |
sp|A9HN95|NUOCD_GLUDA | NADH-quinone oxidoreductase subunit C/D OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=nuoC PE=3 SV=1 | 11 | 98 | 2.0E-09 |
sp|A9WED7|NUOD1_CHLAA | NADH-quinone oxidoreductase subunit D 1 OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=nuoD1 PE=3 SV=1 | 1 | 86 | 3.0E-09 |
sp|B3QY45|NUOD2_CHLT3 | NADH-quinone oxidoreductase subunit D 2 OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=nuoD2 PE=3 SV=1 | 1 | 86 | 3.0E-09 |
sp|F1SVE4|FPOD_METMA | F(420)H(2) dehydrogenase subunit D OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=fpoD PE=1 SV=1 | 11 | 86 | 3.0E-09 |
sp|Q630V1|NUOD_BACCZ | NADH-quinone oxidoreductase subunit D OS=Bacillus cereus (strain ZK / E33L) GN=nuoD PE=3 SV=1 | 11 | 86 | 4.0E-09 |
sp|Q72XF6|NUOD_BACC1 | NADH-quinone oxidoreductase subunit D OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=nuoD PE=3 SV=1 | 11 | 86 | 4.0E-09 |
sp|B0TH80|NUOD_HELMI | NADH-quinone oxidoreductase subunit D OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=nuoD PE=3 SV=1 | 1 | 86 | 5.0E-09 |
sp|A4XC35|NUOD1_SALTO | NADH-quinone oxidoreductase subunit D 1 OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=nuoD1 PE=3 SV=1 | 1 | 87 | 5.0E-09 |
sp|A0LJM5|NUBCD_SYNFM | NADH-quinone oxidoreductase subunit B/C/D OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=nuoBCD PE=3 SV=1 | 11 | 87 | 6.0E-09 |
sp|B3Q6T3|NUOCD_RHOPT | NADH-quinone oxidoreductase subunit C/D OS=Rhodopseudomonas palustris (strain TIE-1) GN=nuoC PE=3 SV=1 | 5 | 87 | 6.0E-09 |
sp|Q11VB5|NUOD2_CYTH3 | NADH-quinone oxidoreductase subunit D 2 OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=nuoD2 PE=3 SV=1 | 2 | 106 | 7.0E-09 |
sp|A0LRI4|NUOD_ACIC1 | NADH-quinone oxidoreductase subunit D OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=nuoD PE=3 SV=1 | 1 | 88 | 9.0E-09 |
sp|Q11XR6|NUOD1_CYTH3 | NADH-quinone oxidoreductase subunit D 1 OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=nuoD1 PE=3 SV=1 | 5 | 88 | 1.0E-08 |
sp|Q13BH3|NUOCD_RHOPS | NADH-quinone oxidoreductase subunit C/D OS=Rhodopseudomonas palustris (strain BisB5) GN=nuoC PE=3 SV=1 | 5 | 87 | 1.0E-08 |
sp|Q30PI1|NUOD_SULDN | NADH-quinone oxidoreductase subunit D OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=nuoD PE=3 SV=1 | 11 | 86 | 1.0E-08 |
sp|Q07QX3|NUOCD_RHOP5 | NADH-quinone oxidoreductase subunit C/D OS=Rhodopseudomonas palustris (strain BisA53) GN=nuoC PE=3 SV=1 | 5 | 87 | 2.0E-08 |
sp|Q6MIR5|NUOCD_BDEBA | NADH-quinone oxidoreductase subunit C/D OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=nuoC PE=3 SV=1 | 7 | 86 | 2.0E-08 |
sp|Q3AC80|NUOD_CARHZ | NADH-quinone oxidoreductase subunit D OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=nuoD PE=3 SV=1 | 11 | 87 | 2.0E-08 |
sp|B5E972|NUBCD_GEOBB | NADH-quinone oxidoreductase subunit B/C/D OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=nuoBCD PE=3 SV=1 | 11 | 87 | 2.0E-08 |
sp|Q1LT91|NUOCD_BAUCH | NADH-quinone oxidoreductase subunit C/D OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=nuoC PE=3 SV=1 | 5 | 86 | 2.0E-08 |
sp|Q72GD1|NUOD_THET2 | NADH-quinone oxidoreductase subunit D OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=nuoD PE=3 SV=1 | 11 | 87 | 2.0E-08 |
sp|Q2YAA3|NUOCD_NITMU | NADH-quinone oxidoreductase subunit C/D OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=nuoC PE=3 SV=1 | 11 | 87 | 3.0E-08 |
sp|Q39ZC4|NUBCD_GEOMG | NADH-quinone oxidoreductase subunit B/C/D OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=nuoBCD PE=3 SV=1 | 11 | 87 | 3.0E-08 |
sp|B5XNV6|NUOCD_KLEP3 | NADH-quinone oxidoreductase subunit C/D OS=Klebsiella pneumoniae (strain 342) GN=nuoC PE=3 SV=1 | 11 | 112 | 3.0E-08 |
sp|Q20Z41|NUOCD_RHOPB | NADH-quinone oxidoreductase subunit C/D OS=Rhodopseudomonas palustris (strain BisB18) GN=nuoC PE=3 SV=1 | 5 | 87 | 3.0E-08 |
sp|Q2RJU4|NUOD_MOOTA | NADH-quinone oxidoreductase subunit D OS=Moorella thermoacetica (strain ATCC 39073) GN=nuoD PE=3 SV=1 | 7 | 87 | 4.0E-08 |
sp|Q56220|NQO4_THET8 | NADH-quinone oxidoreductase subunit 4 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=nqo4 PE=1 SV=1 | 11 | 87 | 4.0E-08 |
sp|Q3JC17|NUOCD_NITOC | NADH-quinone oxidoreductase subunit C/D OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=nuoC PE=3 SV=1 | 11 | 87 | 4.0E-08 |
sp|Q82ED7|NUOD2_STRAW | NADH-quinone oxidoreductase subunit D 2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=nuoD2 PE=3 SV=1 | 11 | 86 | 4.0E-08 |
sp|A4WT70|NUOCD_RHOS5 | NADH-quinone oxidoreductase subunit C/D OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=nuoC PE=3 SV=1 | 11 | 87 | 5.0E-08 |
sp|B0SP85|NUOD_LEPBP | NADH-quinone oxidoreductase subunit D OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=nuoD PE=3 SV=1 | 2 | 86 | 6.0E-08 |
sp|B0SFT7|NUOD_LEPBA | NADH-quinone oxidoreductase subunit D OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=nuoD PE=3 SV=1 | 2 | 86 | 6.0E-08 |
sp|A4FPT8|NUOD_SACEN | NADH-quinone oxidoreductase subunit D OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=nuoD PE=3 SV=1 | 11 | 88 | 6.0E-08 |
sp|B3ES55|NUOD_AMOA5 | NADH-quinone oxidoreductase subunit D OS=Amoebophilus asiaticus (strain 5a2) GN=nuoD PE=3 SV=1 | 1 | 88 | 6.0E-08 |
sp|Q67P19|NUOD1_SYMTH | NADH-quinone oxidoreductase subunit D 1 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=nuoD1 PE=3 SV=1 | 8 | 87 | 6.0E-08 |
sp|Q7N2I9|NUOCD_PHOLL | NADH-quinone oxidoreductase subunit C/D OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=nuoC PE=3 SV=1 | 11 | 87 | 6.0E-08 |
sp|A6TBX2|NUOCD_KLEP7 | NADH-quinone oxidoreductase subunit C/D OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=nuoC PE=3 SV=1 | 11 | 112 | 6.0E-08 |
sp|B9KJI1|NUOCD_RHOSK | NADH-quinone oxidoreductase subunit C/D OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=nuoC PE=3 SV=1 | 11 | 88 | 6.0E-08 |
sp|A6V4E7|NUOCD_PSEA7 | NADH-quinone oxidoreductase subunit C/D OS=Pseudomonas aeruginosa (strain PA7) GN=nuoC PE=3 SV=1 | 11 | 87 | 7.0E-08 |
sp|Q9I0J9|NUOCD_PSEAE | NADH-quinone oxidoreductase subunit C/D OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=nuoC PE=3 SV=1 | 11 | 87 | 7.0E-08 |
sp|Q02ND1|NUOCD_PSEAB | NADH-quinone oxidoreductase subunit C/D OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=nuoC PE=3 SV=1 | 11 | 87 | 7.0E-08 |
sp|Q0S447|NUOD_RHOJR | NADH-quinone oxidoreductase subunit D OS=Rhodococcus jostii (strain RHA1) GN=nuoD PE=3 SV=1 | 1 | 87 | 8.0E-08 |
sp|C3JY83|NUOCD_PSEFS | NADH-quinone oxidoreductase subunit C/D OS=Pseudomonas fluorescens (strain SBW25) GN=nuoC PE=3 SV=1 | 11 | 87 | 8.0E-08 |
sp|Q4K9T4|NUOCD_PSEF5 | NADH-quinone oxidoreductase subunit C/D OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=nuoC PE=3 SV=1 | 11 | 87 | 8.0E-08 |
sp|B4EZC8|NUOCD_PROMH | NADH-quinone oxidoreductase subunit C/D OS=Proteus mirabilis (strain HI4320) GN=nuoC PE=3 SV=1 | 11 | 87 | 8.0E-08 |
sp|A4XV04|NUOCD_PSEMY | NADH-quinone oxidoreductase subunit C/D OS=Pseudomonas mendocina (strain ymp) GN=nuoC PE=3 SV=1 | 11 | 87 | 8.0E-08 |
sp|Q0RRW5|NUOD_FRAAA | NADH-quinone oxidoreductase subunit D OS=Frankia alni (strain ACN14a) GN=nuoD PE=3 SV=1 | 11 | 87 | 8.0E-08 |
sp|Q88FH5|NUOCD_PSEPK | NADH-quinone oxidoreductase subunit C/D OS=Pseudomonas putida (strain KT2440) GN=nuoC PE=3 SV=1 | 11 | 87 | 9.0E-08 |
sp|Q1I7Z8|NUOCD_PSEE4 | NADH-quinone oxidoreductase subunit C/D OS=Pseudomonas entomophila (strain L48) GN=nuoC PE=3 SV=1 | 11 | 87 | 9.0E-08 |
sp|A5W190|NUOCD_PSEP1 | NADH-quinone oxidoreductase subunit C/D OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=nuoC PE=3 SV=1 | 11 | 87 | 9.0E-08 |
sp|B1J6N2|NUOCD_PSEPW | NADH-quinone oxidoreductase subunit C/D OS=Pseudomonas putida (strain W619) GN=nuoC PE=3 SV=1 | 11 | 87 | 1.0E-07 |
sp|A4WCR5|NUOCD_ENT38 | NADH-quinone oxidoreductase subunit C/D OS=Enterobacter sp. (strain 638) GN=nuoC PE=3 SV=1 | 11 | 112 | 1.0E-07 |
sp|Q3KA61|NUOCD_PSEPF | NADH-quinone oxidoreductase subunit C/D OS=Pseudomonas fluorescens (strain Pf0-1) GN=nuoC PE=3 SV=1 | 11 | 87 | 1.0E-07 |
sp|Q6N1Z0|NUOCD_RHOPA | NADH-quinone oxidoreductase subunit C/D OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=nuoC PE=3 SV=1 | 5 | 87 | 1.0E-07 |
sp|Q4ZRJ1|NUOCD_PSEU2 | NADH-quinone oxidoreductase subunit C/D OS=Pseudomonas syringae pv. syringae (strain B728a) GN=nuoC PE=3 SV=1 | 11 | 87 | 1.0E-07 |
sp|B0KMY0|NUOCD_PSEPG | NADH-quinone oxidoreductase subunit C/D OS=Pseudomonas putida (strain GB-1) GN=nuoC PE=3 SV=1 | 11 | 87 | 1.0E-07 |
sp|Q3J1Q7|NUOCD_RHOS4 | NADH-quinone oxidoreductase subunit C/D OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=nuoC PE=3 SV=1 | 11 | 88 | 1.0E-07 |
sp|A1JLG6|NUOCD_YERE8 | NADH-quinone oxidoreductase subunit C/D OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=nuoC PE=3 SV=1 | 11 | 87 | 1.0E-07 |
sp|A3PKI2|NUOCD_RHOS1 | NADH-quinone oxidoreductase subunit C/D OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=nuoC PE=3 SV=1 | 11 | 88 | 1.0E-07 |
sp|Q3Z7Z8|NUOD_DEHM1 | NADH-quinone oxidoreductase subunit D OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=nuoD PE=3 SV=1 | 1 | 91 | 2.0E-07 |
sp|Q87ZQ7|NUOCD_PSESM | NADH-quinone oxidoreductase subunit C/D OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=nuoC PE=3 SV=1 | 11 | 87 | 2.0E-07 |
sp|Q48H52|NUOCD_PSE14 | NADH-quinone oxidoreductase subunit C/D OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=nuoC PE=3 SV=1 | 11 | 87 | 2.0E-07 |
sp|Q1AVI6|NUOD_RUBXD | NADH-quinone oxidoreductase subunit D OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=nuoD PE=3 SV=2 | 3 | 86 | 2.0E-07 |
sp|B1JGL5|NUOCD_YERPY | NADH-quinone oxidoreductase subunit C/D OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=nuoC PE=3 SV=1 | 11 | 87 | 2.0E-07 |
sp|Q669A2|NUOCD_YERPS | NADH-quinone oxidoreductase subunit C/D OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=nuoC PE=3 SV=1 | 11 | 87 | 2.0E-07 |
sp|A4TM34|NUOCD_YERPP | NADH-quinone oxidoreductase subunit C/D OS=Yersinia pestis (strain Pestoides F) GN=nuoC PE=3 SV=1 | 11 | 87 | 2.0E-07 |
sp|Q1CHQ3|NUOCD_YERPN | NADH-quinone oxidoreductase subunit C/D OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=nuoC PE=3 SV=1 | 11 | 87 | 2.0E-07 |
sp|Q7CJ92|NUOCD_YERPE | NADH-quinone oxidoreductase subunit C/D OS=Yersinia pestis GN=nuoC PE=3 SV=1 | 11 | 87 | 2.0E-07 |
sp|B2K819|NUOCD_YERPB | NADH-quinone oxidoreductase subunit C/D OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=nuoC PE=3 SV=1 | 11 | 87 | 2.0E-07 |
sp|Q1C6B1|NUOCD_YERPA | NADH-quinone oxidoreductase subunit C/D OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=nuoC PE=3 SV=1 | 11 | 87 | 2.0E-07 |
sp|A7FGQ7|NUOCD_YERP3 | NADH-quinone oxidoreductase subunit C/D OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=nuoC PE=3 SV=1 | 11 | 87 | 2.0E-07 |
GO Term | Description | Terminal node |
---|---|---|
GO:0051287 | NAD binding | Yes |
GO:0048038 | quinone binding | Yes |
GO:0016651 | oxidoreductase activity, acting on NAD(P)H | Yes |
GO:0097159 | organic cyclic compound binding | No |
GO:0016491 | oxidoreductase activity | No |
GO:1901363 | heterocyclic compound binding | No |
GO:0003824 | catalytic activity | No |
GO:0000166 | nucleotide binding | No |
GO:1901265 | nucleoside phosphate binding | No |
GO:0005488 | binding | No |
GO:0003674 | molecular_function | No |
GO:0036094 | small molecule binding | No |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 12 | 0.45 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >Agabi119p4|616250 MEFYERVSGARSGGVAFDLPHGLLDDIFKWATQFGSRVDEIEEVVTGNRIWRERTIGVGIVTAKQALDFSFSSVM LRGSGVAWDLRNIPRSNSTFLDLLETPPDTYTFVLNKTPHPPS* |
Coding | >Agabi119p4|616250 ATGGAGTTTTACGAACGTGTATCGGGTGCCCGCTCGGGAGGCGTCGCGTTTGACCTTCCTCACGGTTTGCTTGAC GACATCTTCAAATGGGCAACCCAGTTTGGAAGCAGAGTAGACGAGATCGAAGAAGTTGTTACCGGTAATCGTATA TGGAGAGAGCGAACTATCGGTGTCGGTATCGTGACAGCGAAGCAGGCTTTGGATTTCAGCTTTAGTAGTGTCATG CTACGAGGGAGCGGTGTTGCCTGGGACCTGAGAAATATTCCGAGGTCGAATTCAACATTCCTTGACCTTTTGGAA ACCCCTCCGGATACATACACGTTCGTTCTTAACAAGACTCCACATCCTCCATCGTGA |
Transcript | >Agabi119p4|616250 ATGGAGTTTTACGAACGTGTATCGGGTGCCCGCTCGGGAGGCGTCGCGTTTGACCTTCCTCACGGTTTGCTTGAC GACATCTTCAAATGGGCAACCCAGTTTGGAAGCAGAGTAGACGAGATCGAAGAAGTTGTTACCGGTAATCGTATA TGGAGAGAGCGAACTATCGGTGTCGGTATCGTGACAGCGAAGCAGGCTTTGGATTTCAGCTTTAGTAGTGTCATG CTACGAGGGAGCGGTGTTGCCTGGGACCTGAGAAATATTCCGAGGTCGAATTCAACATTCCTTGACCTTTTGGAA ACCCCTCCGGATACATACACGTTCGTTCTTAACAAGACTCCACATCCTCCATCGTGA |
Gene | >Agabi119p4|616250 ATGGAGTTTTACGAACGTGTATCGGGTGCCCGCTCGGGAGGCGTCGCGTTTGACCTTCCTCACGGTTTGCTTGAC GACATCTTCAAATGGGCAACCCAGTTTGGAAGCAGAGTAGACGAGATCGAAGAAGTTGTTACCGGTAATCGTATA TGGAGAGAGCGAACTATCGGTGTCGGTATCGTGACAGCGAAGCAGGCTTTGGATTTCAGCTTTAGTAGTGTCATG CTACGAGGGAGCGGTGTTGCCTGGGACCTGAGAAATATTCCGAGGTTAGTTATACTCTGACTTGACTTAGGCTAT ATATTCAAAGAGCACCCTACAGGTCGAATTCAACATTCCTGTAAGGAGTCGCTTCAGGACGACCGCAGACTCGAG GTTATGTCCAAGCGTCCCTAGTGACCTTTTGGAAACCCCTCCGGATACATACACGTTCGTTCTTAACAAGACTCC ACATCCTCCATCGTGA |