Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|616150
Gene name
Locationscaffold_04:15866..18987
Strand-
Gene length (bp)3121
Transcript length (bp)2562
Coding sequence length (bp)2562
Protein length (aa) 854

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02373 JmjC JmjC domain, hydroxylase 4.2E-12 676 790

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q63679|KDM3A_RAT Lysine-specific demethylase 3A OS=Rattus norvegicus GN=Kdm3a PE=2 SV=1 530 829 3.0E-54
sp|Q6PCM1|KDM3A_MOUSE Lysine-specific demethylase 3A OS=Mus musculus GN=Kdm3a PE=1 SV=1 530 829 7.0E-54
sp|Q9Y4C1|KDM3A_HUMAN Lysine-specific demethylase 3A OS=Homo sapiens GN=KDM3A PE=1 SV=4 530 829 2.0E-53
sp|Q7LBC6|KDM3B_HUMAN Lysine-specific demethylase 3B OS=Homo sapiens GN=KDM3B PE=1 SV=2 519 829 9.0E-53
sp|Q6ZPY7|KDM3B_MOUSE Lysine-specific demethylase 3B OS=Mus musculus GN=Kdm3b PE=1 SV=2 519 829 9.0E-53
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q63679|KDM3A_RAT Lysine-specific demethylase 3A OS=Rattus norvegicus GN=Kdm3a PE=2 SV=1 530 829 3.0E-54
sp|Q6PCM1|KDM3A_MOUSE Lysine-specific demethylase 3A OS=Mus musculus GN=Kdm3a PE=1 SV=1 530 829 7.0E-54
sp|Q9Y4C1|KDM3A_HUMAN Lysine-specific demethylase 3A OS=Homo sapiens GN=KDM3A PE=1 SV=4 530 829 2.0E-53
sp|Q7LBC6|KDM3B_HUMAN Lysine-specific demethylase 3B OS=Homo sapiens GN=KDM3B PE=1 SV=2 519 829 9.0E-53
sp|Q6ZPY7|KDM3B_MOUSE Lysine-specific demethylase 3B OS=Mus musculus GN=Kdm3b PE=1 SV=2 519 829 9.0E-53
sp|Q5ZIX8|KDM3A_CHICK Lysine-specific demethylase 3A OS=Gallus gallus GN=KDM3A PE=2 SV=1 530 829 2.0E-52
sp|Q5HZN1|KD3AB_XENLA Lysine-specific demethylase 3A-B OS=Xenopus laevis GN=kdm3a-b PE=2 SV=1 530 829 3.0E-52
sp|Q6IRB8|KD3AA_XENLA Lysine-specific demethylase 3A-A OS=Xenopus laevis GN=kdm3a-a PE=2 SV=1 530 829 4.0E-51
sp|Q9SSE9|JMJ25_ARATH Lysine-specific demethylase JMJ25 OS=Arabidopsis thaliana GN=JMJ25 PE=1 SV=1 535 829 4.0E-42
sp|Q15652|JHD2C_HUMAN Probable JmjC domain-containing histone demethylation protein 2C OS=Homo sapiens GN=JMJD1C PE=1 SV=2 529 829 2.0E-39
sp|Q69ZK6|JHD2C_MOUSE Probable JmjC domain-containing histone demethylation protein 2C OS=Mus musculus GN=Jmjd1c PE=1 SV=3 530 829 1.0E-37
sp|P97609|HAIR_RAT Lysine-specific demethylase hairless OS=Rattus norvegicus GN=Hr PE=1 SV=2 530 809 7.0E-24
sp|Q61645|HAIR_MOUSE Lysine-specific demethylase hairless OS=Mus musculus GN=Hr PE=2 SV=2 530 809 2.0E-23
sp|O43593|HAIR_HUMAN Lysine-specific demethylase hairless OS=Homo sapiens GN=HR PE=1 SV=5 531 809 3.0E-19
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|616150
MPVTTTTFQPHEDISGRKKGLENYITLDALPTPRATTRTTQSLFDDIVAGNIQLDQNAEYGHDAAWPESKQMELI
ESIFRNMYFSPVVFAVEHHSEGSESKVCIGGKQYLISIQRFMAGLIYCAFTSESSATRTMAEISWHYPQDCPHGA
NEVYWFTAPPSENTKNILPEKYRRQFSNKQVLCIEYTGISDEDRCEIHQRVQLGTVVDSGLASHHTRRTPDIPTP
NLHRKETGASSLVLHSSGTGDNNPNNGLYEPEKAILLQPESQSLPCSGDEYRFQQLNQCVSCAEHRTDDTCRFQN
IRFLLKNKQSDIVGISFAEGRFRNAPKMKFPMRWNIPLMETHTKRMKLALAKTLLPMLKREYKHLKLPELIWRPR
ENEVRATCDTCLTSLSMCTWMCRLCGQELCAECYEQVQELTGEMLSAVQNSFLSRCAKKDKHSTRDFSPVSRFFK
EELIEAIAEMEGLLAQEAGLSRQELNPGRPTILELNSGRIPTLSGALAPPCTAPTRSLITAPILSDEIRRYTYNE
VSKGNSFTVFAPIWVLGEPIVVTGCLEHFKIAWTPQYFIDHYGKEICVIIECQSGEKKRTTVSEFFNMFGRYEGR
ANRWKLKDWPPTADFETAFPELHQDFLSAVPVPDYVRRDGVANISSHFPTNTIAPDLGPKMYNALASNCKEGSKG
TTRLHLDMADALNILMHAENSPDGSPGCAVWDIFRSTDTSKLRTFLHCKFPKQVIDLIHGQEVYLDDVCQKELYK
QFGVKSYRIYQRPGEAIFIPAGCAHQVANLADCIKVAIDFVSVENIAKCESLTREFRDLNQKLPWKEDVLQLKNM
MWFAWLNCGRFEKRELSSRSSGIVEGVL*
Coding >Agabi119p4|616150
ATGCCAGTGACAACGACGACCTTTCAACCGCACGAAGACATCAGTGGACGAAAAAAAGGTTTGGAGAATTATATA
ACCCTAGATGCCCTCCCAACCCCCAGAGCAACGACACGCACCACCCAGTCGCTGTTTGATGACATTGTTGCAGGA
AATATTCAGTTGGATCAAAACGCCGAATACGGGCATGATGCTGCATGGCCGGAATCAAAACAAATGGAACTCATA
GAATCGATTTTCCGCAATATGTACTTCTCACCAGTAGTCTTCGCGGTCGAACACCATAGCGAAGGAAGCGAGAGC
AAGGTTTGCATCGGCGGAAAACAATATTTGATTTCCATTCAGAGGTTTATGGCTGGCCTCATATATTGTGCGTTT
ACATCCGAGTCTTCTGCTACTCGTACAATGGCTGAAATATCATGGCATTACCCTCAAGATTGTCCCCACGGAGCA
AACGAGGTCTATTGGTTCACAGCACCGCCATCGGAAAACACAAAGAATATCCTGCCTGAAAAATACAGGCGCCAG
TTTTCCAATAAACAGGTTTTATGTATCGAATACACTGGCATAAGCGACGAGGACAGATGCGAAATTCATCAGAGA
GTTCAACTCGGGACGGTCGTTGATTCTGGACTCGCTTCTCATCATACAAGGAGAACGCCAGATATTCCTACACCA
AACCTGCATAGAAAGGAAACCGGTGCGTCTTCTTTGGTCCTCCACTCCTCTGGAACTGGGGATAACAACCCAAAC
AATGGATTGTACGAACCCGAAAAGGCGATTCTCCTCCAACCAGAATCACAGTCTTTACCCTGCTCCGGGGATGAA
TACCGCTTTCAACAGTTAAACCAATGTGTGTCTTGTGCCGAGCATCGCACCGATGACACGTGCCGGTTTCAAAAC
ATTCGATTTCTCCTCAAGAACAAGCAAAGTGATATTGTGGGCATCAGTTTTGCTGAAGGACGTTTTCGAAATGCT
CCCAAGATGAAGTTTCCTATGCGCTGGAATATCCCACTAATGGAGACTCATACTAAGCGGATGAAATTGGCTCTC
GCAAAGACCCTACTGCCTATGCTCAAGAGAGAGTACAAACATCTCAAGCTCCCGGAACTCATTTGGAGACCGCGC
GAGAACGAAGTCAGGGCTACATGCGATACATGTCTGACTTCTCTGTCCATGTGTACATGGATGTGCCGGTTGTGT
GGGCAAGAATTATGTGCAGAGTGCTACGAACAAGTCCAGGAGCTTACCGGGGAGATGCTCAGCGCAGTCCAGAAT
TCATTTCTCTCGAGGTGTGCAAAGAAGGATAAGCATTCCACCAGAGATTTTTCGCCGGTTTCAAGGTTCTTCAAG
GAAGAACTAATTGAGGCTATTGCAGAGATGGAGGGGTTGCTTGCGCAAGAGGCTGGATTATCTCGCCAGGAGTTA
AACCCGGGTAGACCGACGATTTTAGAATTGAATTCAGGCAGAATACCGACATTGTCCGGTGCTCTTGCTCCCCCT
TGCACTGCTCCCACTAGATCCCTCATTACAGCGCCAATCCTTTCCGATGAAATTCGCCGATACACGTACAATGAA
GTGTCAAAAGGAAATTCTTTCACTGTCTTTGCACCTATTTGGGTGTTGGGAGAACCAATTGTCGTAACTGGTTGC
CTTGAACATTTCAAAATTGCATGGACACCGCAATATTTTATAGATCACTATGGCAAAGAAATATGTGTCATTATC
GAATGCCAATCTGGGGAAAAGAAGCGCACCACCGTCAGTGAATTCTTTAATATGTTCGGAAGATATGAAGGTAGG
GCCAACCGTTGGAAGCTCAAGGACTGGCCTCCCACTGCCGATTTCGAAACAGCTTTTCCCGAGCTGCATCAAGAT
TTCCTTAGCGCTGTGCCTGTGCCCGATTACGTTCGGCGGGATGGTGTAGCAAATATCAGCTCGCATTTTCCTACA
AACACAATTGCACCTGACTTGGGACCAAAGATGTATAATGCGCTTGCTTCAAACTGCAAGGAAGGGAGTAAAGGG
ACTACAAGGTTGCATTTGGATATGGCCGACGCTTTGAACATTTTAATGCATGCCGAAAACAGTCCCGATGGAAGT
CCGGGATGCGCGGTATGGGACATCTTCCGCTCCACCGATACCAGCAAACTCCGCACATTCCTACATTGCAAATTC
CCAAAGCAAGTCATAGATCTTATTCACGGACAAGAAGTTTACCTTGACGACGTCTGTCAGAAGGAACTCTACAAA
CAATTTGGTGTCAAGTCATATCGAATATATCAACGCCCAGGAGAAGCTATATTCATACCTGCAGGGTGTGCGCAT
CAAGTTGCAAACTTGGCGGATTGTATTAAAGTGGCAATCGATTTTGTTAGCGTGGAGAATATTGCAAAGTGCGAA
AGCTTGACAAGGGAGTTTAGAGATTTGAATCAGAAGTTACCGTGGAAGGAAGATGTTTTGCAGCTCAAGAATATG
ATGTGGTTTGCATGGTTGAATTGTGGCAGGTTTGAGAAGAGAGAGCTAAGTTCTAGGAGTTCAGGGATTGTGGAA
GGGGTATTGTAA
Transcript >Agabi119p4|616150
ATGCCAGTGACAACGACGACCTTTCAACCGCACGAAGACATCAGTGGACGAAAAAAAGGTTTGGAGAATTATATA
ACCCTAGATGCCCTCCCAACCCCCAGAGCAACGACACGCACCACCCAGTCGCTGTTTGATGACATTGTTGCAGGA
AATATTCAGTTGGATCAAAACGCCGAATACGGGCATGATGCTGCATGGCCGGAATCAAAACAAATGGAACTCATA
GAATCGATTTTCCGCAATATGTACTTCTCACCAGTAGTCTTCGCGGTCGAACACCATAGCGAAGGAAGCGAGAGC
AAGGTTTGCATCGGCGGAAAACAATATTTGATTTCCATTCAGAGGTTTATGGCTGGCCTCATATATTGTGCGTTT
ACATCCGAGTCTTCTGCTACTCGTACAATGGCTGAAATATCATGGCATTACCCTCAAGATTGTCCCCACGGAGCA
AACGAGGTCTATTGGTTCACAGCACCGCCATCGGAAAACACAAAGAATATCCTGCCTGAAAAATACAGGCGCCAG
TTTTCCAATAAACAGGTTTTATGTATCGAATACACTGGCATAAGCGACGAGGACAGATGCGAAATTCATCAGAGA
GTTCAACTCGGGACGGTCGTTGATTCTGGACTCGCTTCTCATCATACAAGGAGAACGCCAGATATTCCTACACCA
AACCTGCATAGAAAGGAAACCGGTGCGTCTTCTTTGGTCCTCCACTCCTCTGGAACTGGGGATAACAACCCAAAC
AATGGATTGTACGAACCCGAAAAGGCGATTCTCCTCCAACCAGAATCACAGTCTTTACCCTGCTCCGGGGATGAA
TACCGCTTTCAACAGTTAAACCAATGTGTGTCTTGTGCCGAGCATCGCACCGATGACACGTGCCGGTTTCAAAAC
ATTCGATTTCTCCTCAAGAACAAGCAAAGTGATATTGTGGGCATCAGTTTTGCTGAAGGACGTTTTCGAAATGCT
CCCAAGATGAAGTTTCCTATGCGCTGGAATATCCCACTAATGGAGACTCATACTAAGCGGATGAAATTGGCTCTC
GCAAAGACCCTACTGCCTATGCTCAAGAGAGAGTACAAACATCTCAAGCTCCCGGAACTCATTTGGAGACCGCGC
GAGAACGAAGTCAGGGCTACATGCGATACATGTCTGACTTCTCTGTCCATGTGTACATGGATGTGCCGGTTGTGT
GGGCAAGAATTATGTGCAGAGTGCTACGAACAAGTCCAGGAGCTTACCGGGGAGATGCTCAGCGCAGTCCAGAAT
TCATTTCTCTCGAGGTGTGCAAAGAAGGATAAGCATTCCACCAGAGATTTTTCGCCGGTTTCAAGGTTCTTCAAG
GAAGAACTAATTGAGGCTATTGCAGAGATGGAGGGGTTGCTTGCGCAAGAGGCTGGATTATCTCGCCAGGAGTTA
AACCCGGGTAGACCGACGATTTTAGAATTGAATTCAGGCAGAATACCGACATTGTCCGGTGCTCTTGCTCCCCCT
TGCACTGCTCCCACTAGATCCCTCATTACAGCGCCAATCCTTTCCGATGAAATTCGCCGATACACGTACAATGAA
GTGTCAAAAGGAAATTCTTTCACTGTCTTTGCACCTATTTGGGTGTTGGGAGAACCAATTGTCGTAACTGGTTGC
CTTGAACATTTCAAAATTGCATGGACACCGCAATATTTTATAGATCACTATGGCAAAGAAATATGTGTCATTATC
GAATGCCAATCTGGGGAAAAGAAGCGCACCACCGTCAGTGAATTCTTTAATATGTTCGGAAGATATGAAGGTAGG
GCCAACCGTTGGAAGCTCAAGGACTGGCCTCCCACTGCCGATTTCGAAACAGCTTTTCCCGAGCTGCATCAAGAT
TTCCTTAGCGCTGTGCCTGTGCCCGATTACGTTCGGCGGGATGGTGTAGCAAATATCAGCTCGCATTTTCCTACA
AACACAATTGCACCTGACTTGGGACCAAAGATGTATAATGCGCTTGCTTCAAACTGCAAGGAAGGGAGTAAAGGG
ACTACAAGGTTGCATTTGGATATGGCCGACGCTTTGAACATTTTAATGCATGCCGAAAACAGTCCCGATGGAAGT
CCGGGATGCGCGGTATGGGACATCTTCCGCTCCACCGATACCAGCAAACTCCGCACATTCCTACATTGCAAATTC
CCAAAGCAAGTCATAGATCTTATTCACGGACAAGAAGTTTACCTTGACGACGTCTGTCAGAAGGAACTCTACAAA
CAATTTGGTGTCAAGTCATATCGAATATATCAACGCCCAGGAGAAGCTATATTCATACCTGCAGGGTGTGCGCAT
CAAGTTGCAAACTTGGCGGATTGTATTAAAGTGGCAATCGATTTTGTTAGCGTGGAGAATATTGCAAAGTGCGAA
AGCTTGACAAGGGAGTTTAGAGATTTGAATCAGAAGTTACCGTGGAAGGAAGATGTTTTGCAGCTCAAGAATATG
ATGTGGTTTGCATGGTTGAATTGTGGCAGGTTTGAGAAGAGAGAGCTAAGTTCTAGGAGTTCAGGGATTGTGGAA
GGGGTATTGTAA
Gene >Agabi119p4|616150
ATGCCAGTGACAACGACGACCTTTCAACCGCACGAAGACATCAGTGGACGAAAAAAAGGTTTGGAGAATTATATA
ACCCTAGATGCCCTCCCAACCCCCAGAGCAACGACACGCACCACCCAGTCGCTGTTTGATGACATTGTTGCAGGA
AATATTCAGTTGGATCAAAACGCCGAATACGGGCATGGTGCACACATATTTCATCATGCCGCATCCGTATTCAAC
TAATTGTGTGTCGTAGATGCTGCATGGCCGGAATCAAAACAAATGGAACTCATAGAATCGATTTTCCGCAATATG
TACTTCTCACCAGTAGTCTTCGGTGAGCATATGACTCTGGGGGTGACTCTCAGAGGCTCAGTGGCCTGGGGCAGC
GGTCGAACACCATAGCGAAGGAAGCGAGAGCAAGGTTTGCATCGGCGGAAAACAATATTTGATTTCCATTCAGAG
GTGCGCCTTAATTATATCATGGTCGATACTTCAACAACTCTTCACAGGTTTATGGCTGGCCTCGTGAGTCTATCT
AGTCTCCTTTTCCTCTATGCATTGCTGATGCCCACTTTTCAAGATATATTGTGCGTTTACATCCGAGTCTTCTGC
TACTCGTACAATGGCTGAAATATCATGGCATTACCCTCAAGATTGTCCCCAGTATGTAGGCTTTACGTCTCGGTC
AAAGGGTAGAGCACTAACTACTCCTCTGGCAGCGGAGCAAACGAGGTCTATTGGTTCACAGCACCGCCATCGGAA
AACACAAAGAATATCCTGCCTGAAAAATACAGGCGCCAGTTTTCCAATAAACAGGTTTTATGTATCGAATACACT
GGCATAAGCGACGAGGACAGATGCGAAATTCATCAGGTTTGCATCCACATCATTCTAGTCGTCATTTTCCTGACT
GATTCACTCGATTTCAGAGAGTTCAACTCGGGACGGTCGTTGGTCGGTCGTATTGTGCTTTGACAGTATCTGTAT
GCTGATACTGCACATGTCCAGATTCTGGACTCGCTTCTCATCATACAAGGAGAACGCCAGATATTCCTACACCAA
ACCTGCATAGAAAGGAAACCGGTGCGTCTTCTTTGGTCCTCCACTCCTCTGGAACTGGTTATATTGATTTATTGT
TGGATTCTTTGGTCTGCGTTACTTTCTGCACATGCACATGTAGGGGATAACAACCCAAACAATGGATTGTACGAA
CCCGAAAAGGCGATTCTCCTCCAACCAGAATCACAGTCTTTACCCTGCTCCGGGGATGAATACCGCTTTCAACAG
TTAAACCAATGTGTGTCTTGTGCCGAGCATCGCACCGATGACACGTGCCGGTTTCAAAACATTCGATTTCTCCTC
AAGAACAAGCAAAGTGATATTGTGGGCATCAGTTTTGCTGAAGGACGTTTTCGAAATGCTCCCAAGATGAAGTTT
CCTATGCGCTGGAATATCCCACTAATGGAGACTCATACTAAGCGGATGAAAGTCAGTATCCCAGTTGTTTTGAGA
GTAAATGCAAATGAACATTATACCTGTGTTTAGTTGGCTCTCGCAAAGACCCTACTGCCTATGCTCAAGAGAGAG
TACAAACATCTCAAGCTCCCGGAACTCATTTGGAGACCGCGCGAGAACGAAGTCAGGGCTACATGCGGTCAGTAA
CTGGTTGACCTATCGAAATCATCCTTTCAAGTTTTGAACTTGGCGTGATCTTCTTCCAGATACATGTCTGACTTC
TCTGTCCATGTGTACATGGATGTGCCGGTTGTGTGGGCAAGAATTATGTGCAGAGTGCTACGAACAAGTCCAGGA
GCTTACCGGGGAGATGCTCAGCGCAGTCCAGAATTCATTTCTCTCGAGGTGTGCAAAGAAGGATAAGCATTCCAC
CAGAGATTTTTCGCCGGTTTCAAGGTTCTTCAAGGAAGAACTAATTGAGGCTATTGCAGAGATGGAGGGGTTGCT
TGCGCAAGAGGCTGGATTATCTCGCCAGGAGTTAAACCCGGGTAGACCGACGATTTTAGAATTGAATTCAGGCAG
AATACCGACATTGTCCGGTGCTCTTGCTCCCCCTTGCACTGCTCCCACTAGATCCCTCATTACAGCGCCAATCCT
TTCCGATGAAATTCGCCGATACACGTACAATGAAGTGTCAAAAGGAAATTCTTTCACTGTCTTTGCACCTATTTG
GGTGTTGGGAGAACCAATTGTCGTAACTGGTTGCCTTGAACATTTCAAAATTGCATGGACACCGCAATATTTTAT
AGATCACTATGGCAAAGAAATATGTGTCATTATCGAATGCCAATCTGGGGAAAAGAAGCGCACCACCGTCAGTGA
ATTCTTTAATATGTTCGGAAGATATGAAGGTAGGGCCAACCGTTGGAAGCTCAAGGACTGGCCTCCCACTGCCGA
TTTCGAAACAGCTTTTCCCGAGCTGCATCAAGATTTCCTTAGCGCTGTGCCTGTGCCCGATTACGTTCGGCGGGA
TGGTGTAGCAAATATCAGCTCGCATTTTCCTACAAACACAATTGCACCTGACTTGGGACCAAAGATGTATAATGC
GCTTGCTTCAAACTGCAAGGAAGGGAGTAAAGGGACTACAAGGTTGCATTTGGATATGGCCGACGCTTTGAACAT
TTTAATGCATGCCGAAAACAGTCCCGATGGAAGTCCGGGATGCGCGGTATGGGACATCTTCCGCTCCACCGATAC
CAGCAAACTCCGCACATTCCTACATTGCAAATTCCCAAAGCAAGTCATAGATCTTATTCACGGACAAGAAGTTTA
CCTTGACGACGTCTGTCAGAAGGAACTCTACAAACAATTTGGTGTCAAGTCATATCGAATATATCAACGCCCAGG
AGAAGCTATATTCATACCTGCAGGGTGTGCGCATCAAGTTGCAAACTTGGCGGATTGTATTAAAGTGGCAATCGA
TTTTGTTAGCGTGGAGAATATTGCAAAGTGCGAAAGCTTGACAAGGGAGTTTAGAGATTTGAATCAGAAGTTACC
GTGGAAGGAAGATGTTTTGCAGCTCAAGAATATGATGTGGTTTGCATGGTTGAATTGTGGCAGGTTTGAGAAGAG
AGAGCTAAGTTCTAGGAGTTCAGGGATTGTGGAAGGGGTATTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail