Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|615050
Gene name
Locationscaffold_03b:1126834..1128328
Strand-
Gene length (bp)1494
Transcript length (bp)1284
Coding sequence length (bp)1284
Protein length (aa) 428

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01328 Peroxidase_2 Peroxidase, family 2 1.5E-47 68 285

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|B9W4V6|APO1_AGRAE Aromatic peroxygenase OS=Agrocybe aegerita GN=APO1 PE=1 SV=1 12 377 2.0E-128
sp|B9W4V8|APO1_COPRA Aromatic peroxygenase (Fragments) OS=Coprinellus radians GN=APO PE=1 SV=2 50 283 9.0E-71
sp|Q00668|STCC_EMENI Putative sterigmatocystin biosynthesis peroxidase stcC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcC PE=3 SV=2 74 278 9.0E-21
sp|P04963|PRXC_LEPFU Chloroperoxidase OS=Leptoxyphium fumago GN=CPO PE=1 SV=3 69 221 2.0E-07

GO

GO Term Description Terminal node
GO:0004601 peroxidase activity Yes
GO:0016491 oxidoreductase activity No
GO:0016684 oxidoreductase activity, acting on peroxide as acceptor No
GO:0016209 antioxidant activity No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|615050
MVGFLSFVTLAIALAAPATAFPAHGSLAGLSRQELDDAMSGFGEYKRPPPPPGPLEYGGVKLVNDADHPFIAPGE
GDIRGPCPALNTLANHGYISRNGIESPSNIVRGAMEGFNMNNDLSKFTCYAAFMVNGNLITDLVSIGEKSPKTGP
DPKEQPMATIGGLNTHNVFEGDSSMTRADFYDGGDVESFNETLFQGFIEYSNRFGGGRYNLTAAGEFRLKRIQDG
VQHNPTFTIVAPRLFSAYSEAVNPINMWVDGRQDDGQLRLDHARSFFEAARFPDDFHRAARPMSADNEAVVHAIH
PIEPGANIAGVNTYTVDRNAPRLDDKCGIFEYHVNHTLRTLYPNPTGNLLDAIRANIHYFYTAMEARGCTEIFPY
GRFEDGESNNYYAPPDYPEVELPELGTFPYPPVELPTYSDPLVDVGPGATTA*
Coding >Agabi119p4|615050
ATGGTCGGCTTCCTATCCTTCGTCACCCTCGCAATCGCGCTGGCTGCTCCTGCTACCGCATTCCCAGCTCATGGT
TCATTGGCTGGCTTATCGAGGCAAGAATTGGACGATGCCATGAGTGGCTTCGGCGAATACAAAAGGCCGCCACCA
CCCCCAGGACCCCTCGAGTACGGTGGTGTCAAGTTGGTCAACGATGCCGACCATCCTTTCATTGCTCCGGGTGAA
GGCGACATCCGTGGTCCTTGCCCGGCTTTGAACACTCTCGCCAACCACGGTTACATCAGCCGCAATGGTATCGAG
TCTCCTTCTAACATCGTCCGTGGCGCCATGGAAGGTTTCAACATGAACAACGACTTGTCCAAGTTCACTTGCTAC
GCTGCCTTCATGGTCAACGGAAACTTGATCACTGACTTGGTCAGTATCGGTGAGAAGTCCCCGAAGACTGGACCC
GACCCAAAAGAACAACCGATGGCGACCATTGGTGGATTGAACACTCACAACGTGTTCGAGGGTGACAGCTCTATG
ACTCGCGCTGATTTCTATGATGGTGGTGATGTCGAGAGCTTCAACGAGACCCTGTTCCAAGGCTTCATTGAATAC
AGCAACAGGTTCGGTGGTGGAAGGTACAACCTTACCGCTGCCGGCGAGTTCCGTCTCAAACGTATTCAAGACGGT
GTCCAGCACAACCCGACCTTCACCATCGTCGCTCCCCGACTCTTCTCTGCTTACTCCGAAGCCGTCAACCCCATC
AACATGTGGGTAGATGGACGCCAAGACGATGGACAACTCAGGCTCGACCATGCCCGCAGCTTCTTTGAGGCCGCA
CGTTTCCCCGATGACTTCCACAGGGCTGCGCGCCCCATGAGCGCTGACAACGAGGCCGTTGTCCATGCTATCCAC
CCCATTGAGCCCGGAGCAAACATTGCCGGTGTCAACACTTACACTGTGGACCGTAATGCACCCAGACTCGACGAC
AAGTGTGGTATCTTCGAGTACCACGTCAACCACACTCTCCGTACGCTCTACCCCAACCCGACCGGTAACTTGTTG
GACGCCATCAGGGCCAACATCCATTACTTCTACACCGCCATGGAAGCTAGGGGTTGCACAGAAATCTTCCCTTAC
GGTAGATTCGAGGATGGTGAAAGCAACAACTACTACGCTCCCCCTGATTACCCCGAAGTCGAGCTCCCCGAGCTG
GGAACTTTCCCCTATCCCCCAGTCGAGCTCCCTACATACTCTGACCCCCTCGTAGACGTCGGCCCCGGAGCTACC
ACCGCCTAA
Transcript >Agabi119p4|615050
ATGGTCGGCTTCCTATCCTTCGTCACCCTCGCAATCGCGCTGGCTGCTCCTGCTACCGCATTCCCAGCTCATGGT
TCATTGGCTGGCTTATCGAGGCAAGAATTGGACGATGCCATGAGTGGCTTCGGCGAATACAAAAGGCCGCCACCA
CCCCCAGGACCCCTCGAGTACGGTGGTGTCAAGTTGGTCAACGATGCCGACCATCCTTTCATTGCTCCGGGTGAA
GGCGACATCCGTGGTCCTTGCCCGGCTTTGAACACTCTCGCCAACCACGGTTACATCAGCCGCAATGGTATCGAG
TCTCCTTCTAACATCGTCCGTGGCGCCATGGAAGGTTTCAACATGAACAACGACTTGTCCAAGTTCACTTGCTAC
GCTGCCTTCATGGTCAACGGAAACTTGATCACTGACTTGGTCAGTATCGGTGAGAAGTCCCCGAAGACTGGACCC
GACCCAAAAGAACAACCGATGGCGACCATTGGTGGATTGAACACTCACAACGTGTTCGAGGGTGACAGCTCTATG
ACTCGCGCTGATTTCTATGATGGTGGTGATGTCGAGAGCTTCAACGAGACCCTGTTCCAAGGCTTCATTGAATAC
AGCAACAGGTTCGGTGGTGGAAGGTACAACCTTACCGCTGCCGGCGAGTTCCGTCTCAAACGTATTCAAGACGGT
GTCCAGCACAACCCGACCTTCACCATCGTCGCTCCCCGACTCTTCTCTGCTTACTCCGAAGCCGTCAACCCCATC
AACATGTGGGTAGATGGACGCCAAGACGATGGACAACTCAGGCTCGACCATGCCCGCAGCTTCTTTGAGGCCGCA
CGTTTCCCCGATGACTTCCACAGGGCTGCGCGCCCCATGAGCGCTGACAACGAGGCCGTTGTCCATGCTATCCAC
CCCATTGAGCCCGGAGCAAACATTGCCGGTGTCAACACTTACACTGTGGACCGTAATGCACCCAGACTCGACGAC
AAGTGTGGTATCTTCGAGTACCACGTCAACCACACTCTCCGTACGCTCTACCCCAACCCGACCGGTAACTTGTTG
GACGCCATCAGGGCCAACATCCATTACTTCTACACCGCCATGGAAGCTAGGGGTTGCACAGAAATCTTCCCTTAC
GGTAGATTCGAGGATGGTGAAAGCAACAACTACTACGCTCCCCCTGATTACCCCGAAGTCGAGCTCCCCGAGCTG
GGAACTTTCCCCTATCCCCCAGTCGAGCTCCCTACATACTCTGACCCCCTCGTAGACGTCGGCCCCGGAGCTACC
ACCGCCTAA
Gene >Agabi119p4|615050
ATGGTCGGCTTCCTATCCTTCGTCACCCTCGCAATCGCGCTGGCTGCTCCTGCTACCGCATTCCCAGCTCATGGT
TCATTGGCTGGCTTATCGAGGCAAGAATTGGACGATGCCATGAGTGGCTTCGGCGAATACAAAAGGCCGCCACCA
CCCCCAGGACCCCTCGAGTACGGTGGTGTCAAGTTGGTCAACGATGCCGACCATCCTTTCATTGCTCCGGGTGAA
GGCGACATCCGTGGTCCTTGCCCGGCTTTGAACACTCTCGCCAACCACGGTGTACGTACCATTATTCTAGTTTGC
TTCTCGGTAACATCTGACCCCCAAATTGACAGTACATCAGCCGCAATGGTATCGAGTCTCCTTCTAACATCGTCC
GTGGCGCCATGGAAGGTCGGTGCTTCAGCTTTTCCTTCATGTCCTTTCGCTGACTTTGAACAGGTTTCAACATGA
ACAACGACTTGTCCAAGTTCACTTGCTACGCTGCCTTCATGGTCAACGGAAACTTGATCACTGACTTGGTCAGTA
TCGGTGAGAAGTCCCCGAAGACTGGACCCGACCCAAAAGAACAACCGATGGCGACCATTGGTGGATTGAACACTC
ACAACGTGTTCGAGGGTGACAGCTCTATGACTCGCGGTGAGTTTCGCGCATAGCCACTTTTATCCTAATCAAATG
GCTTACTTGGTCTCTAGCTGATTTCTATGATGGTGGTGATGTCGAGAGCTTCAACGAGACCCTGTTCCAAGGCGT
ATGTTGCTCCGTATTTTTCGAAGTTTCCAGCATCTGATCACATTACAGTTCATTGAATACAGCAACAGGTTCGGT
GGTGGAAGGTACAACCTTACCGCTGCCGGCGAGTTCCGTCTCAAACGTATTCAAGACGGTGTCCAGCACAACCCG
ACCTTCACCATCGTCGCTCCCCGACTCTTCTCTGCTTACTCCGAAGCCGTCAACCCCATCAACATGTGGGTAGAT
GGACGCCAAGACGATGGACAACTCAGGCTCGACCATGCCCGCAGCTTCTTTGAGGCCGCACGTTTCCCCGATGAC
TTCCACAGGGCTGCGCGCCCCATGAGCGCTGACAACGAGGCCGTTGTCCATGCTATCCACCCCATTGAGCCCGGA
GCAAACATTGCCGGTGTCAACACTTACACTGTGGACCGTAATGCACCCAGACTCGACGACAAGTGTGGTATCTTC
GAGTACCACGTCAACCACACTCTCCGTACGCTCTACCCCAACCCGACCGGTAACTTGTTGGACGCCATCAGGGCC
AACATCCATTACTTCTACACCGCCATGGAAGCTAGGGGTTGCACAGAAATCTTCCCTTACGGTAGATTCGAGGAT
GGTGAAAGCAACAACTACTACGCTCCCCCTGATTACCCCGAAGTCGAGCTCCCCGAGCTGGGAACTTTCCCCTAT
CCCCCAGTCGAGCTCCCTACATACTCTGACCCCCTCGTAGACGTCGGCCCCGGAGCTACCACCGCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail