Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|614650
Gene name
Locationscaffold_03b:1099251..1100107
Strand+
Gene length (bp)856
Transcript length (bp)561
Coding sequence length (bp)561
Protein length (aa) 187

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07855 ATG101 Autophagy-related protein 101 2.7E-39 15 167

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O13978|MUG66_SCHPO Meiotically up-regulated gene 66 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug66 PE=1 SV=1 10 173 4.0E-16
sp|F4K265|AT101_ARATH Autophagy-related protein 101 OS=Arabidopsis thaliana GN=ATG101 PE=1 SV=1 14 179 3.0E-13

GO

GO Term Description Terminal node
GO:0006914 autophagy Yes
GO:0044237 cellular metabolic process No
GO:0044248 cellular catabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0061919 process utilizing autophagic mechanism No
GO:0009987 cellular process No
GO:0009056 catabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|614650
MSNVSPTFPTITIDLGLDRQTFKDVLTGVLHSILFHRLFGLIRPQVFEVLDITMPGVDDPGMEHLIQDKVDTFWR
AIQTDTDRRGQIVVTFSMKGPKKSWYQLYQVEEDIPWEQWIINTELRQYRTDQDRQMFYTNLTTALTKSIQTMLS
HTSSERGRTAVPPITQSTGISPFPFKITVKVGGEDL*
Coding >Agabi119p4|614650
ATGTCCAACGTTAGCCCTACGTTTCCAACAATCACTATCGACCTGGGGCTTGACCGTCAGACATTCAAAGATGTC
CTAACCGGCGTCCTCCATTCTATTCTCTTTCATAGATTATTCGGTCTTATACGACCGCAAGTATTTGAGGTTCTT
GACATCACTATGCCAGGCGTTGATGACCCGGGAATGGAACATCTCATTCAAGATAAAGTAGACACCTTTTGGAGA
GCCATTCAAACCGATACAGATAGACGTGGTCAGATCGTTGTAACGTTCTCGATGAAAGGGCCCAAAAAGTCATGG
TATCAACTTTATCAAGTCGAAGAAGATATACCTTGGGAACAATGGATTATCAATACTGAACTTCGTCAGTATCGA
ACGGACCAAGACCGTCAAATGTTTTATACAAATCTTACTACCGCCCTAACGAAATCCATTCAAACCATGCTCAGT
CATACATCTTCCGAACGCGGTCGAACGGCTGTACCTCCAATAACTCAATCTACAGGCATATCGCCTTTCCCTTTC
AAAATCACCGTTAAAGTCGGTGGTGAAGATTTATAG
Transcript >Agabi119p4|614650
ATGTCCAACGTTAGCCCTACGTTTCCAACAATCACTATCGACCTGGGGCTTGACCGTCAGACATTCAAAGATGTC
CTAACCGGCGTCCTCCATTCTATTCTCTTTCATAGATTATTCGGTCTTATACGACCGCAAGTATTTGAGGTTCTT
GACATCACTATGCCAGGCGTTGATGACCCGGGAATGGAACATCTCATTCAAGATAAAGTAGACACCTTTTGGAGA
GCCATTCAAACCGATACAGATAGACGTGGTCAGATCGTTGTAACGTTCTCGATGAAAGGGCCCAAAAAGTCATGG
TATCAACTTTATCAAGTCGAAGAAGATATACCTTGGGAACAATGGATTATCAATACTGAACTTCGTCAGTATCGA
ACGGACCAAGACCGTCAAATGTTTTATACAAATCTTACTACCGCCCTAACGAAATCCATTCAAACCATGCTCAGT
CATACATCTTCCGAACGCGGTCGAACGGCTGTACCTCCAATAACTCAATCTACAGGCATATCGCCTTTCCCTTTC
AAAATCACCGTTAAAGTCGGTGGTGAAGATTTATAG
Gene >Agabi119p4|614650
ATGTCCAACGTTAGCCCTACGTTTCCAACAATCACTATCGACCTGGTAAGTCTTGTCCGAATCTTTCAAATCTGT
GTTTTCCCAACGTCTGTTCAAACAGTTCTAGGGGCTTGACCGTCAGACATTCAAAGATGTCCTAACCGGCGTCCT
CCATTCTATTCTCTTTCATAGATTATTCGGTCTTATACGACCGCAAGTATTTGAGGTTCTTGACATCACTATGGT
GTGACACTCGATTCTTTCTGCTATTGTAACCTATTTTTCTGATTTGCTGTTGAAGCCAGGCGTTGATGACCCGGG
AATGGAACATCTCATTCAAGATAAAGTAGACACCTTTTGGAGAGCCATTCAAACCGATACAGATAGACGTGGTCA
GGTACGTCTACCGCATGCGTTTAATTACCGCCAGTTACCACTGACCCATTACTCTTAGATCGTTGTAACGTTCTC
GATGAAAGGGCCCAAAAAGTCATGGTATCAACTTTATCAAGTCGAAGAAGATATACCTTGGGAACAATGGTTCGC
GTTATCTTAGCATTCTCTCTATTCAATCCATCTTACACATCTCAACTCTCAGGATTATCAATACTGAACTTCGTC
AGTATCGAACGGACCAAGGTACTGCCTGGTTTTTTTCCGGTAATCCAAATGAATTCACTTTCATTTATAATCTGC
TGTAGACCGTCAAATGTTTTATACAAATCTTACTACCGCCCTAACGAAATCCATTCAAACCATGCTCAGTCATAC
ATCTTCCGAACGCGGTCGAACGGCTGTACCTCCAATAACTCAATCTACAGGCATATCGCCTTTCCCTTTCAAAAT
CACCGTTAAAGTCGGTGGTGAAGATTTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail