Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|613400
Gene name
Locationscaffold_03b:891749..895946
Strand-
Gene length (bp)4197
Transcript length (bp)4197
Coding sequence length (bp)4197
Protein length (aa) 1399

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07727 RVT_2 Reverse transcriptase (RNA-dependent DNA polymerase) 8.6E-67 910 1155
PF00665 rve Integrase core domain 1.9E-13 534 630
PF14223 Retrotran_gag_2 gag-polypeptide of LTR copia-type 5.0E-13 96 209
PF13976 gag_pre-integrs GAG-pre-integrase domain 5.8E-07 475 519

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 84 1395 0.0E+00
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 879 1395 8.0E-98
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 87 742 2.0E-52
sp|P25600|YCH4_YEAST Putative transposon Ty5-1 protein YCL074W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY5A PE=5 SV=2 989 1302 3.0E-41
sp|Q12501|YO22B_YEAST Transposon Ty2-OR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR2 PE=1 SV=1 342 678 1.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 84 1395 0.0E+00
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 879 1395 8.0E-98
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 87 742 2.0E-52
sp|P25600|YCH4_YEAST Putative transposon Ty5-1 protein YCL074W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY5A PE=5 SV=2 989 1302 3.0E-41
sp|Q12501|YO22B_YEAST Transposon Ty2-OR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR2 PE=1 SV=1 342 678 1.0E-28
sp|Q12337|YG21B_YEAST Transposon Ty2-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR1 PE=5 SV=2 305 678 1.0E-28
sp|P25384|YC21B_YEAST Transposon Ty2-C Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-C PE=3 SV=2 342 678 1.0E-28
sp|Q12472|YD21B_YEAST Transposon Ty2-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR1 PE=1 SV=3 342 678 2.0E-28
sp|Q12113|YO21B_YEAST Transposon Ty2-OR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR1 PE=3 SV=1 342 678 2.0E-28
sp|P0CX64|YG22B_YEAST Transposon Ty2-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR2 PE=3 SV=1 342 678 2.0E-28
sp|P0CX63|YF21B_YEAST Transposon Ty2-F Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-F PE=3 SV=1 342 678 2.0E-28
sp|P0C2J3|YL21B_YEAST Transposon Ty2-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR1 PE=3 SV=1 342 678 2.0E-28
sp|Q03494|YD22B_YEAST Transposon Ty2-DR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR2 PE=3 SV=2 342 678 2.0E-28
sp|P0C2J5|YL22B_YEAST Transposon Ty2-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR2 PE=5 SV=1 342 678 2.0E-28
sp|Q12491|YB21B_YEAST Transposon Ty2-B Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-B PE=3 SV=1 342 678 2.0E-28
sp|Q07791|YD23B_YEAST Transposon Ty2-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR3 PE=3 SV=1 342 678 2.0E-28
sp|P92519|M810_ARATH Uncharacterized mitochondrial protein AtMg00810 OS=Arabidopsis thaliana GN=AtMg00810 PE=4 SV=1 1075 1305 3.0E-27
sp|Q99337|YN12B_YEAST Transposon Ty1-NL2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL2 PE=3 SV=1 922 1382 4.0E-25
sp|Q99231|YD12B_YEAST Transposon Ty1-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR3 PE=1 SV=2 922 1382 2.0E-24
sp|Q12501|YO22B_YEAST Transposon Ty2-OR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR2 PE=1 SV=1 894 1382 4.0E-24
sp|P25384|YC21B_YEAST Transposon Ty2-C Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-C PE=3 SV=2 894 1382 4.0E-24
sp|Q12337|YG21B_YEAST Transposon Ty2-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR1 PE=5 SV=2 894 1382 5.0E-24
sp|Q12472|YD21B_YEAST Transposon Ty2-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR1 PE=1 SV=3 878 1382 5.0E-24
sp|Q12113|YO21B_YEAST Transposon Ty2-OR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR1 PE=3 SV=1 894 1382 5.0E-24
sp|P0CX64|YG22B_YEAST Transposon Ty2-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR2 PE=3 SV=1 894 1382 5.0E-24
sp|P0CX63|YF21B_YEAST Transposon Ty2-F Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-F PE=3 SV=1 894 1382 5.0E-24
sp|P0C2J3|YL21B_YEAST Transposon Ty2-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR1 PE=3 SV=1 894 1382 5.0E-24
sp|Q03494|YD22B_YEAST Transposon Ty2-DR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR2 PE=3 SV=2 894 1382 5.0E-24
sp|Q12491|YB21B_YEAST Transposon Ty2-B Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-B PE=3 SV=1 878 1382 7.0E-24
sp|P0C2I3|YD15B_YEAST Transposon Ty1-DR6 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR6 PE=3 SV=1 922 1382 7.0E-24
sp|P0C2I7|YL14B_YEAST Transposon Ty1-LR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR4 PE=5 SV=1 922 1382 7.0E-24
sp|Q03855|YD11B_YEAST Transposon Ty1-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR1 PE=3 SV=2 922 1382 8.0E-24
sp|Q12269|YG12B_YEAST Transposon Ty1-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR2 PE=3 SV=3 922 1382 2.0E-23
sp|P0C2I6|YL13B_YEAST Transposon Ty1-LR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR3 PE=3 SV=1 922 1382 5.0E-23
sp|Q07163|TY1AB_YEASX Transposon TyH3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae GN=TY1B PE=1 SV=2 922 1382 5.0E-23
sp|P0C2I9|YP12B_YEAST Transposon Ty1-PR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR1 PE=3 SV=1 922 1382 6.0E-23
sp|Q07791|YD23B_YEAST Transposon Ty2-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR3 PE=3 SV=1 894 1382 8.0E-23
sp|O13527|YA11B_YEAST Truncated transposon Ty1-A Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-A PE=3 SV=3 922 1382 8.0E-23
sp|P0C2I5|YL12B_YEAST Transposon Ty1-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR2 PE=3 SV=1 922 1382 2.0E-22
sp|Q12414|YP11B_YEAST Transposon Ty1-PL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PL PE=3 SV=1 922 1382 2.0E-22
sp|Q03434|YM12B_YEAST Transposon Ty1-ML2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML2 PE=3 SV=2 922 1382 2.0E-22
sp|P47098|YJ11B_YEAST Transposon Ty1-JR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR1 PE=3 SV=3 922 1382 2.0E-22
sp|Q03612|YE11B_YEAST Transposon Ty1-ER1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER1 PE=3 SV=1 922 1382 2.0E-22
sp|Q12273|YO11B_YEAST Transposon Ty1-OL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OL PE=3 SV=1 922 1382 2.0E-22
sp|Q12193|YB12B_YEAST Transposon Ty1-BR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BR PE=3 SV=1 922 1382 2.0E-22
sp|Q04670|YM14B_YEAST Transposon Ty1-MR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR2 PE=3 SV=2 922 1382 4.0E-22
sp|Q03619|YE12B_YEAST Transposon Ty1-ER2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER2 PE=3 SV=1 922 1382 5.0E-22
sp|P47100|YJ12B_YEAST Transposon Ty1-JR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR2 PE=3 SV=3 922 1382 5.0E-22
sp|Q12141|YG11B_YEAST Transposon Ty1-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR1 PE=3 SV=1 922 1382 5.0E-22
sp|Q92393|YO12B_YEAST Transposon Ty1-OR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OR PE=3 SV=1 922 1382 6.0E-22
sp|Q12490|YB11B_YEAST Transposon Ty1-BL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BL PE=1 SV=1 922 1382 6.0E-22
sp|Q12316|YG13B_YEAST Transposon Ty1-GR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR3 PE=3 SV=3 922 1382 6.0E-22
sp|Q12112|YN11B_YEAST Transposon Ty1-NL1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL1 PE=3 SV=1 922 1382 7.0E-22
sp|Q04214|YM13B_YEAST Transposon Ty1-MR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR1 PE=1 SV=2 922 1382 1.0E-21
sp|Q12088|YL11B_YEAST Transposon Ty1-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR1 PE=3 SV=1 922 1382 2.0E-21
sp|O13535|YH11B_YEAST Transposon Ty1-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-H PE=3 SV=1 922 1382 2.0E-21
sp|P0C2J0|YP13B_YEAST Transposon Ty1-PR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR2 PE=3 SV=1 922 1382 5.0E-21
sp|P0C2I2|YD14B_YEAST Transposon Ty1-DR5 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR5 PE=3 SV=1 922 1382 5.0E-21
sp|Q04711|YM11B_YEAST Transposon Ty1-ML1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML1 PE=3 SV=2 922 1382 6.0E-21
sp|P0C2J1|YP14B_YEAST Transposon Ty1-PR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR3 PE=1 SV=1 922 1382 1.0E-20
sp|Q12193|YB12B_YEAST Transposon Ty1-BR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BR PE=3 SV=1 342 670 3.0E-20
sp|Q03612|YE11B_YEAST Transposon Ty1-ER1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER1 PE=3 SV=1 342 670 4.0E-20
sp|Q04670|YM14B_YEAST Transposon Ty1-MR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR2 PE=3 SV=2 342 670 4.0E-20
sp|Q92393|YO12B_YEAST Transposon Ty1-OR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OR PE=3 SV=1 342 670 4.0E-20
sp|Q04711|YM11B_YEAST Transposon Ty1-ML1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML1 PE=3 SV=2 342 670 4.0E-20
sp|P0C2I9|YP12B_YEAST Transposon Ty1-PR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR1 PE=3 SV=1 342 670 5.0E-20
sp|Q12273|YO11B_YEAST Transposon Ty1-OL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OL PE=3 SV=1 342 670 5.0E-20
sp|P47100|YJ12B_YEAST Transposon Ty1-JR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR2 PE=3 SV=3 342 670 5.0E-20
sp|Q12490|YB11B_YEAST Transposon Ty1-BL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BL PE=1 SV=1 342 670 5.0E-20
sp|Q12088|YL11B_YEAST Transposon Ty1-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR1 PE=3 SV=1 342 670 5.0E-20
sp|O13535|YH11B_YEAST Transposon Ty1-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-H PE=3 SV=1 342 670 5.0E-20
sp|P0C2I6|YL13B_YEAST Transposon Ty1-LR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR3 PE=3 SV=1 342 670 6.0E-20
sp|P47098|YJ11B_YEAST Transposon Ty1-JR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR1 PE=3 SV=3 342 670 6.0E-20
sp|Q03619|YE12B_YEAST Transposon Ty1-ER2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER2 PE=3 SV=1 342 670 6.0E-20
sp|Q12141|YG11B_YEAST Transposon Ty1-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR1 PE=3 SV=1 342 670 6.0E-20
sp|Q12316|YG13B_YEAST Transposon Ty1-GR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR3 PE=3 SV=3 342 670 6.0E-20
sp|Q04214|YM13B_YEAST Transposon Ty1-MR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR1 PE=1 SV=2 342 670 6.0E-20
sp|P0C2J1|YP14B_YEAST Transposon Ty1-PR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR3 PE=1 SV=1 342 670 6.0E-20
sp|Q99337|YN12B_YEAST Transposon Ty1-NL2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL2 PE=3 SV=1 342 670 7.0E-20
sp|P0C2I2|YD14B_YEAST Transposon Ty1-DR5 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR5 PE=3 SV=1 342 670 7.0E-20
sp|Q07793|YD13B_YEAST Transposon Ty1-DR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR4 PE=3 SV=2 342 670 7.0E-20
sp|Q03855|YD11B_YEAST Transposon Ty1-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR1 PE=3 SV=2 342 670 8.0E-20
sp|Q12414|YP11B_YEAST Transposon Ty1-PL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PL PE=3 SV=1 342 670 8.0E-20
sp|Q99231|YD12B_YEAST Transposon Ty1-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR3 PE=1 SV=2 342 670 9.0E-20
sp|P0C2I7|YL14B_YEAST Transposon Ty1-LR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR4 PE=5 SV=1 342 670 9.0E-20
sp|Q12269|YG12B_YEAST Transposon Ty1-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR2 PE=3 SV=3 342 670 9.0E-20
sp|Q07163|TY1AB_YEASX Transposon TyH3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae GN=TY1B PE=1 SV=2 342 670 9.0E-20
sp|Q12112|YN11B_YEAST Transposon Ty1-NL1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL1 PE=3 SV=1 342 670 9.0E-20
sp|Q03434|YM12B_YEAST Transposon Ty1-ML2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML2 PE=3 SV=2 342 678 1.0E-19
sp|P0C2J0|YP13B_YEAST Transposon Ty1-PR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR2 PE=3 SV=1 342 670 1.0E-19
sp|P0C2I3|YD15B_YEAST Transposon Ty1-DR6 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR6 PE=3 SV=1 342 670 2.0E-19
sp|P0C2I5|YL12B_YEAST Transposon Ty1-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR2 PE=3 SV=1 342 670 2.0E-19
sp|P47024|YJ41B_YEAST Transposon Ty4-J Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-J PE=3 SV=3 894 1238 1.0E-18
sp|P0C2J7|YH41B_YEAST Transposon Ty4-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-H PE=3 SV=1 894 1238 1.0E-18
sp|P92520|M820_ARATH Uncharacterized mitochondrial protein AtMg00820 OS=Arabidopsis thaliana GN=AtMg00820 PE=4 SV=1 892 988 8.0E-18
sp|O13527|YA11B_YEAST Truncated transposon Ty1-A Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-A PE=3 SV=3 491 670 7.0E-17
sp|A0A0B7P3V8|YP41B_YEAST Transposon Ty4-P Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-P PE=5 SV=2 470 715 5.0E-16
sp|Q07793|YD13B_YEAST Transposon Ty1-DR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR4 PE=3 SV=2 922 1157 6.0E-16
sp|P47024|YJ41B_YEAST Transposon Ty4-J Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-J PE=3 SV=3 470 715 6.0E-16
sp|P0C2J7|YH41B_YEAST Transposon Ty4-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-H PE=3 SV=1 470 715 7.0E-16
sp|P0C2J5|YL22B_YEAST Transposon Ty2-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR2 PE=5 SV=1 894 1157 7.0E-15
sp|P92512|M710_ARATH Uncharacterized mitochondrial protein AtMg00710 OS=Arabidopsis thaliana GN=AtMg00710 PE=4 SV=1 645 728 1.0E-08
sp|A1Z651|POL_XMRV6 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP62) GN=gag-pol PE=1 SV=1 465 706 2.0E-08
sp|Q2F7J0|POL_XMRV4 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP42) GN=gag-pol PE=3 SV=1 465 706 2.0E-08
sp|Q2F7J3|POL_XMRV3 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP35) GN=gag-pol PE=1 SV=1 465 706 6.0E-08
sp|P03356|POL_MLVAV Pol polyprotein OS=AKV murine leukemia virus GN=pol PE=3 SV=2 466 706 2.0E-07
sp|P11227|POL_MLVRD Pol polyprotein OS=Radiation murine leukemia virus GN=pol PE=3 SV=1 466 706 6.0E-07
sp|P31795|POL_MLVRK Pol polyprotein (Fragment) OS=Radiation murine leukemia virus (strain Kaplan) GN=pol PE=3 SV=1 466 706 2.0E-06
sp|P26809|POL_MLVFF Pol polyprotein OS=Friend murine leukemia virus (isolate FB29) GN=pol PE=3 SV=1 510 703 3.0E-06
sp|P26808|POL_MLVFP Pol polyprotein OS=Friend murine leukemia virus (isolate PVC-211) GN=pol PE=3 SV=1 510 703 4.0E-06
sp|P26810|POL_MLVF5 Pol polyprotein OS=Friend murine leukemia virus (isolate 57) GN=pol PE=3 SV=1 510 703 4.0E-06
sp|P93290|M240_ARATH Uncharacterized mitochondrial protein AtMg00240 OS=Arabidopsis thaliana GN=AtMg00240 PE=4 SV=1 1189 1269 6.0E-06
sp|P03355|POL_MLVMS Gag-Pol polyprotein OS=Moloney murine leukemia virus (isolate Shinnick) GN=gag-pol PE=1 SV=4 510 703 7.0E-06
sp|P21414|POL_GALV Pol polyprotein OS=Gibbon ape leukemia virus GN=pol PE=3 SV=1 477 699 7.0E-06
sp|P31792|POL_FENV1 Pol polyprotein (Fragment) OS=Feline endogenous virus ECE1 GN=pol PE=3 SV=1 504 704 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0015074 DNA integration Yes
GO:0044260 cellular macromolecule metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0009987 cellular process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0043170 macromolecule metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0006259 DNA metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|613400
MSNSMAVNDTLPPNVPALDISGSNWAMFELRFRMVVRGKGLWGHFDGTTPRPALPTPTPAPTPAPPSTPAAPTES
AVQAALPPSPPPVTIDDIELWDRNESISQALLAQRIPDSTLVVVASYPTVQQMWKAVVNEYTYKSDYSQANLHQE
FMASRCPPGGDVRVFLTNLRAKKSELLAVGVHISDNEYRSAIIQSLPRWLATFASNQLSAARLHSSLGKTIDPDL
LIIMICDEWDRTRRFSKKTAKPEGDDALGVEAENKGKSKAKEKSKGKEKKKGPCWICGGEHLKKDCPKRKDKKEE
GSKKDQSTSANVTTEGGDDDESFAVDVEEVGKASQSTARIKIFDSGSSRHISPYRDVFTSFTSTSPCMLRTANRQ
QFSAIGKGEVKLDLPNGDSKSELHLKDVLYSPEASYMLISVGRLDTEGYTTTFRDGRCIIRNAESVRVAEIPRNE
KGLYKLVNDDYDEVNVGELLTKDALHRRLGHISPMAAEKLVKDGLVTGLKLSEVEFGNVSCDSCAYAKATRLPIV
KVRQGDRATKVGEEVHTDIWGPARVATRKGRRYYITFTDDYSRWTYVEFLSQKSDAFEAYKRYEAWMGTQYDARI
KVLHSDRGGEYTSEEFQSYLKSRGTEIKLTVHDTPQHNGIAERRNRTIVERARALLHSSGLPKSFWAEAVAHVVW
LMNRTGTKAVEGKTPFEVLYNRKPYMGNVREWGDKVWVHQAGQDKLGARAKKGRWLGFDSESNGSRILFSDTGAV
KIERNFRFIKGNTNLELEGEKVITPQAPPASVLAPAKPAESPTTPESPSVGTPTRTESPSLPVEPDIHPEISDPV
SEPPTTSRPVRKKFPSQKARDILEGKAVTVAEELDWEEVHVLVNETDEMEALEPRTWKEATQRDDWPLWKKAMEE
ELTTLKTAGTWELVDCPLGINVVGSKWVFKAKKDATGNVVRYKARLVAQGFSQVPGVDYFDTFAPVARLSSIRTA
LAIATARNLEIHQIDVKGAYLNGRLNNDEVVYMRQPPGFSDPTHPHYVCHLKKTLYGLKQSGRRWYQRLCEILID
NLGYSRCDVDHGVFFRVIQDDLVIILVHVDDCTLVATKLELIRELKERMNEFVEVTDLGEIHWLLGIEIRRDRNE
GKLYMSQRSYIDSCLRRYGFEDAKPVSIPMDPSIHYSTNQSPKSTAEIARMARIPYQEAVGSLMYAAIATRPDIA
FAIQVLSKFSKNPGIDHWEAVKRVFRYLKGTKELWLTFGGQGDTLEGFADADGNMAEDRHAISGFAFIINGGAVS
WSAKRQEIVTLSTTESEYVAVTHATKEALWLRSLISQIFGAILPTTPLFSDNQSAIALTKDHKYHGRTKHIDIRY
HFIRWIVEEGKVRLVYCPTADMIADTLTKALPSPKVKHFASALGLATV*
Coding >Agabi119p4|613400
ATGTCGAATTCGATGGCTGTAAATGATACTCTACCACCCAATGTGCCTGCATTGGACATTTCGGGATCAAATTGG
GCTATGTTCGAGTTGAGATTCCGGATGGTCGTTCGAGGGAAAGGCCTATGGGGTCATTTCGATGGGACTACTCCT
CGTCCTGCTCTTCCTACTCCTACTCCTGCACCTACACCAGCACCACCTAGTACTCCGGCAGCTCCTACGGAATCT
GCTGTTCAGGCAGCTTTACCCCCATCTCCACCTCCAGTTACAATTGATGACATCGAGTTGTGGGACCGAAATGAA
AGTATTTCGCAAGCGCTGCTCGCTCAGCGAATCCCCGACTCCACTCTCGTTGTTGTTGCAAGTTACCCCACAGTT
CAACAGATGTGGAAAGCGGTTGTCAATGAATATACTTACAAGAGTGATTATTCACAAGCAAATCTCCATCAGGAA
TTCATGGCCTCGCGCTGTCCACCTGGAGGTGATGTTCGAGTATTCTTGACTAACTTGAGGGCGAAGAAGTCGGAG
CTACTAGCAGTCGGCGTTCATATTAGCGATAATGAATACCGAAGTGCCATAATTCAATCCTTACCTCGATGGCTA
GCAACATTTGCGTCCAACCAGTTATCTGCTGCTCGTCTTCACTCCTCCCTTGGCAAAACTATCGATCCGGACCTG
CTCATTATCATGATATGTGATGAATGGGATCGTACACGCCGTTTTTCCAAAAAGACAGCTAAGCCGGAAGGGGAT
GATGCTCTTGGAGTTGAAGCCGAAAATAAAGGGAAGTCTAAAGCCAAAGAGAAGAGTAAAGGAAAGGAGAAGAAG
AAGGGACCGTGTTGGATTTGTGGAGGGGAGCACTTGAAGAAGGATTGTCCTAAGCGAAAGGATAAAAAGGAGGAA
GGATCTAAGAAAGATCAATCCACCAGCGCCAATGTTACGACCGAAGGAGGTGATGACGATGAGTCATTTGCTGTA
GATGTTGAAGAAGTCGGGAAAGCTAGCCAGTCGACGGCAAGAATCAAGATCTTTGATTCAGGATCTTCTCGTCAT
ATTTCTCCCTACCGAGATGTGTTCACGTCGTTCACATCGACTTCACCCTGCATGTTGCGAACTGCTAATCGGCAA
CAATTTAGTGCAATCGGTAAAGGAGAAGTGAAGCTTGACTTACCGAATGGAGACTCAAAGTCAGAGTTACATCTC
AAGGATGTTCTCTATTCACCAGAAGCTAGCTATATGCTTATATCGGTTGGCCGTTTGGACACAGAAGGCTATACG
ACGACGTTCAGGGATGGGCGTTGTATAATCCGAAATGCGGAAAGTGTTCGTGTAGCGGAAATCCCTCGAAACGAA
AAGGGATTATACAAGTTGGTCAACGATGACTACGACGAGGTCAATGTAGGCGAATTACTCACCAAAGATGCCCTA
CATCGTCGCCTAGGTCATATTTCACCTATGGCTGCAGAGAAACTAGTCAAGGATGGGCTGGTTACAGGGTTAAAG
TTGAGCGAAGTTGAATTCGGGAATGTATCCTGTGATTCTTGCGCATATGCTAAAGCCACCCGTTTGCCGATTGTG
AAAGTCCGACAAGGCGACAGAGCGACGAAAGTTGGCGAGGAAGTGCACACAGATATTTGGGGACCAGCTAGAGTG
GCAACACGCAAAGGACGACGTTATTATATTACGTTCACAGATGATTATTCTCGTTGGACGTACGTGGAGTTTCTA
TCCCAAAAGTCGGATGCTTTCGAGGCATACAAGCGGTATGAAGCATGGATGGGGACTCAATACGATGCGCGTATC
AAAGTACTTCACTCGGATCGTGGAGGGGAATACACATCTGAGGAGTTTCAGTCTTATCTCAAATCTCGTGGTACA
GAAATAAAGCTCACTGTTCACGATACTCCACAGCACAACGGTATTGCCGAGCGTCGAAACCGTACGATCGTTGAA
CGCGCTCGAGCTCTGCTTCATTCGAGTGGTCTTCCAAAGTCGTTTTGGGCAGAAGCTGTAGCGCACGTAGTATGG
TTGATGAATAGAACTGGAACTAAAGCGGTTGAAGGAAAAACGCCGTTTGAAGTCCTATATAATCGAAAGCCATAT
ATGGGAAATGTTCGTGAGTGGGGTGATAAAGTATGGGTTCACCAAGCAGGACAAGATAAACTAGGAGCGCGGGCG
AAGAAAGGCCGTTGGTTGGGATTTGATTCAGAGAGTAATGGATCTAGGATCCTATTCTCTGATACTGGGGCAGTT
AAGATCGAGCGTAATTTTCGCTTCATCAAAGGGAATACTAACCTGGAACTTGAGGGGGAGAAAGTAATTACTCCA
CAGGCACCTCCTGCATCCGTTCTTGCCCCAGCAAAACCGGCTGAATCCCCTACAACTCCGGAGTCACCAAGCGTT
GGTACTCCAACCCGAACCGAATCGCCATCGCTACCAGTTGAACCGGATATCCATCCAGAGATCTCGGATCCAGTA
TCCGAACCGCCTACAACTTCGCGTCCTGTAAGGAAGAAATTTCCTAGCCAGAAAGCTCGCGACATTCTTGAAGGG
AAAGCTGTTACTGTTGCTGAAGAATTGGACTGGGAAGAAGTTCATGTTTTAGTAAATGAAACAGACGAGATGGAG
GCTTTAGAACCTCGTACCTGGAAAGAGGCTACCCAGAGGGATGATTGGCCATTGTGGAAGAAGGCGATGGAAGAG
GAACTGACCACGTTGAAGACTGCCGGCACATGGGAACTTGTTGATTGTCCTCTTGGCATCAACGTCGTGGGATCA
AAATGGGTTTTCAAAGCGAAAAAGGACGCTACAGGTAACGTTGTTCGTTACAAGGCTCGTCTGGTGGCCCAGGGC
TTTTCACAAGTACCGGGTGTTGATTATTTCGACACGTTTGCACCAGTAGCACGATTGTCGTCAATCCGAACCGCA
CTCGCTATCGCGACGGCTCGGAACTTAGAAATCCATCAGATAGATGTCAAGGGAGCTTACCTAAACGGTAGACTC
AACAACGACGAAGTCGTCTACATGCGTCAACCTCCCGGTTTTTCTGATCCTACCCATCCCCACTACGTCTGTCAT
CTCAAAAAGACACTTTACGGCCTCAAGCAGTCCGGACGGCGATGGTATCAACGCCTCTGTGAAATTCTCATTGAC
AATCTGGGCTATTCACGCTGTGATGTCGATCACGGCGTCTTCTTTCGTGTCATTCAAGATGATTTGGTCATCATC
CTTGTCCATGTCGATGATTGTACTCTGGTGGCGACAAAGCTTGAACTTATCAGAGAGTTGAAAGAGCGGATGAAT
GAGTTTGTAGAGGTAACTGACCTCGGAGAAATTCATTGGCTTTTGGGGATAGAAATTCGAAGGGATCGTAATGAA
GGCAAGTTATATATGTCTCAAAGGTCGTACATTGATTCGTGTCTCCGACGATATGGTTTCGAGGATGCTAAACCA
GTTAGTATCCCTATGGATCCATCTATCCACTATTCTACCAACCAGTCACCGAAATCAACCGCCGAAATCGCTCGC
ATGGCACGTATACCCTACCAAGAGGCCGTAGGATCACTTATGTATGCAGCGATTGCTACTCGACCGGACATCGCC
TTCGCAATCCAAGTTCTTTCGAAATTTTCGAAGAATCCCGGAATTGATCATTGGGAAGCCGTTAAGCGAGTTTTC
AGGTACTTAAAAGGTACGAAAGAATTGTGGTTGACCTTTGGAGGTCAAGGAGATACGTTGGAAGGTTTTGCCGAT
GCGGATGGAAACATGGCAGAGGATCGACATGCTATTTCAGGTTTCGCGTTCATCATCAACGGTGGTGCCGTTTCA
TGGAGTGCGAAACGTCAGGAAATTGTTACCCTGTCCACAACGGAATCAGAGTACGTAGCTGTCACTCATGCTACC
AAAGAAGCCTTGTGGCTTCGTTCTCTCATCTCGCAGATTTTCGGAGCAATCCTTCCCACCACACCACTTTTCTCC
GACAATCAATCCGCTATTGCGCTTACAAAAGACCATAAGTATCATGGTCGCACAAAACATATCGACATACGGTAC
CACTTTATTCGATGGATCGTCGAAGAAGGAAAAGTCCGCCTGGTTTATTGTCCCACTGCGGACATGATTGCGGAT
ACATTGACAAAAGCTTTACCATCTCCAAAGGTAAAGCATTTCGCATCTGCGTTAGGCCTCGCCACGGTTTGA
Transcript >Agabi119p4|613400
ATGTCGAATTCGATGGCTGTAAATGATACTCTACCACCCAATGTGCCTGCATTGGACATTTCGGGATCAAATTGG
GCTATGTTCGAGTTGAGATTCCGGATGGTCGTTCGAGGGAAAGGCCTATGGGGTCATTTCGATGGGACTACTCCT
CGTCCTGCTCTTCCTACTCCTACTCCTGCACCTACACCAGCACCACCTAGTACTCCGGCAGCTCCTACGGAATCT
GCTGTTCAGGCAGCTTTACCCCCATCTCCACCTCCAGTTACAATTGATGACATCGAGTTGTGGGACCGAAATGAA
AGTATTTCGCAAGCGCTGCTCGCTCAGCGAATCCCCGACTCCACTCTCGTTGTTGTTGCAAGTTACCCCACAGTT
CAACAGATGTGGAAAGCGGTTGTCAATGAATATACTTACAAGAGTGATTATTCACAAGCAAATCTCCATCAGGAA
TTCATGGCCTCGCGCTGTCCACCTGGAGGTGATGTTCGAGTATTCTTGACTAACTTGAGGGCGAAGAAGTCGGAG
CTACTAGCAGTCGGCGTTCATATTAGCGATAATGAATACCGAAGTGCCATAATTCAATCCTTACCTCGATGGCTA
GCAACATTTGCGTCCAACCAGTTATCTGCTGCTCGTCTTCACTCCTCCCTTGGCAAAACTATCGATCCGGACCTG
CTCATTATCATGATATGTGATGAATGGGATCGTACACGCCGTTTTTCCAAAAAGACAGCTAAGCCGGAAGGGGAT
GATGCTCTTGGAGTTGAAGCCGAAAATAAAGGGAAGTCTAAAGCCAAAGAGAAGAGTAAAGGAAAGGAGAAGAAG
AAGGGACCGTGTTGGATTTGTGGAGGGGAGCACTTGAAGAAGGATTGTCCTAAGCGAAAGGATAAAAAGGAGGAA
GGATCTAAGAAAGATCAATCCACCAGCGCCAATGTTACGACCGAAGGAGGTGATGACGATGAGTCATTTGCTGTA
GATGTTGAAGAAGTCGGGAAAGCTAGCCAGTCGACGGCAAGAATCAAGATCTTTGATTCAGGATCTTCTCGTCAT
ATTTCTCCCTACCGAGATGTGTTCACGTCGTTCACATCGACTTCACCCTGCATGTTGCGAACTGCTAATCGGCAA
CAATTTAGTGCAATCGGTAAAGGAGAAGTGAAGCTTGACTTACCGAATGGAGACTCAAAGTCAGAGTTACATCTC
AAGGATGTTCTCTATTCACCAGAAGCTAGCTATATGCTTATATCGGTTGGCCGTTTGGACACAGAAGGCTATACG
ACGACGTTCAGGGATGGGCGTTGTATAATCCGAAATGCGGAAAGTGTTCGTGTAGCGGAAATCCCTCGAAACGAA
AAGGGATTATACAAGTTGGTCAACGATGACTACGACGAGGTCAATGTAGGCGAATTACTCACCAAAGATGCCCTA
CATCGTCGCCTAGGTCATATTTCACCTATGGCTGCAGAGAAACTAGTCAAGGATGGGCTGGTTACAGGGTTAAAG
TTGAGCGAAGTTGAATTCGGGAATGTATCCTGTGATTCTTGCGCATATGCTAAAGCCACCCGTTTGCCGATTGTG
AAAGTCCGACAAGGCGACAGAGCGACGAAAGTTGGCGAGGAAGTGCACACAGATATTTGGGGACCAGCTAGAGTG
GCAACACGCAAAGGACGACGTTATTATATTACGTTCACAGATGATTATTCTCGTTGGACGTACGTGGAGTTTCTA
TCCCAAAAGTCGGATGCTTTCGAGGCATACAAGCGGTATGAAGCATGGATGGGGACTCAATACGATGCGCGTATC
AAAGTACTTCACTCGGATCGTGGAGGGGAATACACATCTGAGGAGTTTCAGTCTTATCTCAAATCTCGTGGTACA
GAAATAAAGCTCACTGTTCACGATACTCCACAGCACAACGGTATTGCCGAGCGTCGAAACCGTACGATCGTTGAA
CGCGCTCGAGCTCTGCTTCATTCGAGTGGTCTTCCAAAGTCGTTTTGGGCAGAAGCTGTAGCGCACGTAGTATGG
TTGATGAATAGAACTGGAACTAAAGCGGTTGAAGGAAAAACGCCGTTTGAAGTCCTATATAATCGAAAGCCATAT
ATGGGAAATGTTCGTGAGTGGGGTGATAAAGTATGGGTTCACCAAGCAGGACAAGATAAACTAGGAGCGCGGGCG
AAGAAAGGCCGTTGGTTGGGATTTGATTCAGAGAGTAATGGATCTAGGATCCTATTCTCTGATACTGGGGCAGTT
AAGATCGAGCGTAATTTTCGCTTCATCAAAGGGAATACTAACCTGGAACTTGAGGGGGAGAAAGTAATTACTCCA
CAGGCACCTCCTGCATCCGTTCTTGCCCCAGCAAAACCGGCTGAATCCCCTACAACTCCGGAGTCACCAAGCGTT
GGTACTCCAACCCGAACCGAATCGCCATCGCTACCAGTTGAACCGGATATCCATCCAGAGATCTCGGATCCAGTA
TCCGAACCGCCTACAACTTCGCGTCCTGTAAGGAAGAAATTTCCTAGCCAGAAAGCTCGCGACATTCTTGAAGGG
AAAGCTGTTACTGTTGCTGAAGAATTGGACTGGGAAGAAGTTCATGTTTTAGTAAATGAAACAGACGAGATGGAG
GCTTTAGAACCTCGTACCTGGAAAGAGGCTACCCAGAGGGATGATTGGCCATTGTGGAAGAAGGCGATGGAAGAG
GAACTGACCACGTTGAAGACTGCCGGCACATGGGAACTTGTTGATTGTCCTCTTGGCATCAACGTCGTGGGATCA
AAATGGGTTTTCAAAGCGAAAAAGGACGCTACAGGTAACGTTGTTCGTTACAAGGCTCGTCTGGTGGCCCAGGGC
TTTTCACAAGTACCGGGTGTTGATTATTTCGACACGTTTGCACCAGTAGCACGATTGTCGTCAATCCGAACCGCA
CTCGCTATCGCGACGGCTCGGAACTTAGAAATCCATCAGATAGATGTCAAGGGAGCTTACCTAAACGGTAGACTC
AACAACGACGAAGTCGTCTACATGCGTCAACCTCCCGGTTTTTCTGATCCTACCCATCCCCACTACGTCTGTCAT
CTCAAAAAGACACTTTACGGCCTCAAGCAGTCCGGACGGCGATGGTATCAACGCCTCTGTGAAATTCTCATTGAC
AATCTGGGCTATTCACGCTGTGATGTCGATCACGGCGTCTTCTTTCGTGTCATTCAAGATGATTTGGTCATCATC
CTTGTCCATGTCGATGATTGTACTCTGGTGGCGACAAAGCTTGAACTTATCAGAGAGTTGAAAGAGCGGATGAAT
GAGTTTGTAGAGGTAACTGACCTCGGAGAAATTCATTGGCTTTTGGGGATAGAAATTCGAAGGGATCGTAATGAA
GGCAAGTTATATATGTCTCAAAGGTCGTACATTGATTCGTGTCTCCGACGATATGGTTTCGAGGATGCTAAACCA
GTTAGTATCCCTATGGATCCATCTATCCACTATTCTACCAACCAGTCACCGAAATCAACCGCCGAAATCGCTCGC
ATGGCACGTATACCCTACCAAGAGGCCGTAGGATCACTTATGTATGCAGCGATTGCTACTCGACCGGACATCGCC
TTCGCAATCCAAGTTCTTTCGAAATTTTCGAAGAATCCCGGAATTGATCATTGGGAAGCCGTTAAGCGAGTTTTC
AGGTACTTAAAAGGTACGAAAGAATTGTGGTTGACCTTTGGAGGTCAAGGAGATACGTTGGAAGGTTTTGCCGAT
GCGGATGGAAACATGGCAGAGGATCGACATGCTATTTCAGGTTTCGCGTTCATCATCAACGGTGGTGCCGTTTCA
TGGAGTGCGAAACGTCAGGAAATTGTTACCCTGTCCACAACGGAATCAGAGTACGTAGCTGTCACTCATGCTACC
AAAGAAGCCTTGTGGCTTCGTTCTCTCATCTCGCAGATTTTCGGAGCAATCCTTCCCACCACACCACTTTTCTCC
GACAATCAATCCGCTATTGCGCTTACAAAAGACCATAAGTATCATGGTCGCACAAAACATATCGACATACGGTAC
CACTTTATTCGATGGATCGTCGAAGAAGGAAAAGTCCGCCTGGTTTATTGTCCCACTGCGGACATGATTGCGGAT
ACATTGACAAAAGCTTTACCATCTCCAAAGGTAAAGCATTTCGCATCTGCGTTAGGCCTCGCCACGGTTTGA
Gene >Agabi119p4|613400
ATGTCGAATTCGATGGCTGTAAATGATACTCTACCACCCAATGTGCCTGCATTGGACATTTCGGGATCAAATTGG
GCTATGTTCGAGTTGAGATTCCGGATGGTCGTTCGAGGGAAAGGCCTATGGGGTCATTTCGATGGGACTACTCCT
CGTCCTGCTCTTCCTACTCCTACTCCTGCACCTACACCAGCACCACCTAGTACTCCGGCAGCTCCTACGGAATCT
GCTGTTCAGGCAGCTTTACCCCCATCTCCACCTCCAGTTACAATTGATGACATCGAGTTGTGGGACCGAAATGAA
AGTATTTCGCAAGCGCTGCTCGCTCAGCGAATCCCCGACTCCACTCTCGTTGTTGTTGCAAGTTACCCCACAGTT
CAACAGATGTGGAAAGCGGTTGTCAATGAATATACTTACAAGAGTGATTATTCACAAGCAAATCTCCATCAGGAA
TTCATGGCCTCGCGCTGTCCACCTGGAGGTGATGTTCGAGTATTCTTGACTAACTTGAGGGCGAAGAAGTCGGAG
CTACTAGCAGTCGGCGTTCATATTAGCGATAATGAATACCGAAGTGCCATAATTCAATCCTTACCTCGATGGCTA
GCAACATTTGCGTCCAACCAGTTATCTGCTGCTCGTCTTCACTCCTCCCTTGGCAAAACTATCGATCCGGACCTG
CTCATTATCATGATATGTGATGAATGGGATCGTACACGCCGTTTTTCCAAAAAGACAGCTAAGCCGGAAGGGGAT
GATGCTCTTGGAGTTGAAGCCGAAAATAAAGGGAAGTCTAAAGCCAAAGAGAAGAGTAAAGGAAAGGAGAAGAAG
AAGGGACCGTGTTGGATTTGTGGAGGGGAGCACTTGAAGAAGGATTGTCCTAAGCGAAAGGATAAAAAGGAGGAA
GGATCTAAGAAAGATCAATCCACCAGCGCCAATGTTACGACCGAAGGAGGTGATGACGATGAGTCATTTGCTGTA
GATGTTGAAGAAGTCGGGAAAGCTAGCCAGTCGACGGCAAGAATCAAGATCTTTGATTCAGGATCTTCTCGTCAT
ATTTCTCCCTACCGAGATGTGTTCACGTCGTTCACATCGACTTCACCCTGCATGTTGCGAACTGCTAATCGGCAA
CAATTTAGTGCAATCGGTAAAGGAGAAGTGAAGCTTGACTTACCGAATGGAGACTCAAAGTCAGAGTTACATCTC
AAGGATGTTCTCTATTCACCAGAAGCTAGCTATATGCTTATATCGGTTGGCCGTTTGGACACAGAAGGCTATACG
ACGACGTTCAGGGATGGGCGTTGTATAATCCGAAATGCGGAAAGTGTTCGTGTAGCGGAAATCCCTCGAAACGAA
AAGGGATTATACAAGTTGGTCAACGATGACTACGACGAGGTCAATGTAGGCGAATTACTCACCAAAGATGCCCTA
CATCGTCGCCTAGGTCATATTTCACCTATGGCTGCAGAGAAACTAGTCAAGGATGGGCTGGTTACAGGGTTAAAG
TTGAGCGAAGTTGAATTCGGGAATGTATCCTGTGATTCTTGCGCATATGCTAAAGCCACCCGTTTGCCGATTGTG
AAAGTCCGACAAGGCGACAGAGCGACGAAAGTTGGCGAGGAAGTGCACACAGATATTTGGGGACCAGCTAGAGTG
GCAACACGCAAAGGACGACGTTATTATATTACGTTCACAGATGATTATTCTCGTTGGACGTACGTGGAGTTTCTA
TCCCAAAAGTCGGATGCTTTCGAGGCATACAAGCGGTATGAAGCATGGATGGGGACTCAATACGATGCGCGTATC
AAAGTACTTCACTCGGATCGTGGAGGGGAATACACATCTGAGGAGTTTCAGTCTTATCTCAAATCTCGTGGTACA
GAAATAAAGCTCACTGTTCACGATACTCCACAGCACAACGGTATTGCCGAGCGTCGAAACCGTACGATCGTTGAA
CGCGCTCGAGCTCTGCTTCATTCGAGTGGTCTTCCAAAGTCGTTTTGGGCAGAAGCTGTAGCGCACGTAGTATGG
TTGATGAATAGAACTGGAACTAAAGCGGTTGAAGGAAAAACGCCGTTTGAAGTCCTATATAATCGAAAGCCATAT
ATGGGAAATGTTCGTGAGTGGGGTGATAAAGTATGGGTTCACCAAGCAGGACAAGATAAACTAGGAGCGCGGGCG
AAGAAAGGCCGTTGGTTGGGATTTGATTCAGAGAGTAATGGATCTAGGATCCTATTCTCTGATACTGGGGCAGTT
AAGATCGAGCGTAATTTTCGCTTCATCAAAGGGAATACTAACCTGGAACTTGAGGGGGAGAAAGTAATTACTCCA
CAGGCACCTCCTGCATCCGTTCTTGCCCCAGCAAAACCGGCTGAATCCCCTACAACTCCGGAGTCACCAAGCGTT
GGTACTCCAACCCGAACCGAATCGCCATCGCTACCAGTTGAACCGGATATCCATCCAGAGATCTCGGATCCAGTA
TCCGAACCGCCTACAACTTCGCGTCCTGTAAGGAAGAAATTTCCTAGCCAGAAAGCTCGCGACATTCTTGAAGGG
AAAGCTGTTACTGTTGCTGAAGAATTGGACTGGGAAGAAGTTCATGTTTTAGTAAATGAAACAGACGAGATGGAG
GCTTTAGAACCTCGTACCTGGAAAGAGGCTACCCAGAGGGATGATTGGCCATTGTGGAAGAAGGCGATGGAAGAG
GAACTGACCACGTTGAAGACTGCCGGCACATGGGAACTTGTTGATTGTCCTCTTGGCATCAACGTCGTGGGATCA
AAATGGGTTTTCAAAGCGAAAAAGGACGCTACAGGTAACGTTGTTCGTTACAAGGCTCGTCTGGTGGCCCAGGGC
TTTTCACAAGTACCGGGTGTTGATTATTTCGACACGTTTGCACCAGTAGCACGATTGTCGTCAATCCGAACCGCA
CTCGCTATCGCGACGGCTCGGAACTTAGAAATCCATCAGATAGATGTCAAGGGAGCTTACCTAAACGGTAGACTC
AACAACGACGAAGTCGTCTACATGCGTCAACCTCCCGGTTTTTCTGATCCTACCCATCCCCACTACGTCTGTCAT
CTCAAAAAGACACTTTACGGCCTCAAGCAGTCCGGACGGCGATGGTATCAACGCCTCTGTGAAATTCTCATTGAC
AATCTGGGCTATTCACGCTGTGATGTCGATCACGGCGTCTTCTTTCGTGTCATTCAAGATGATTTGGTCATCATC
CTTGTCCATGTCGATGATTGTACTCTGGTGGCGACAAAGCTTGAACTTATCAGAGAGTTGAAAGAGCGGATGAAT
GAGTTTGTAGAGGTAACTGACCTCGGAGAAATTCATTGGCTTTTGGGGATAGAAATTCGAAGGGATCGTAATGAA
GGCAAGTTATATATGTCTCAAAGGTCGTACATTGATTCGTGTCTCCGACGATATGGTTTCGAGGATGCTAAACCA
GTTAGTATCCCTATGGATCCATCTATCCACTATTCTACCAACCAGTCACCGAAATCAACCGCCGAAATCGCTCGC
ATGGCACGTATACCCTACCAAGAGGCCGTAGGATCACTTATGTATGCAGCGATTGCTACTCGACCGGACATCGCC
TTCGCAATCCAAGTTCTTTCGAAATTTTCGAAGAATCCCGGAATTGATCATTGGGAAGCCGTTAAGCGAGTTTTC
AGGTACTTAAAAGGTACGAAAGAATTGTGGTTGACCTTTGGAGGTCAAGGAGATACGTTGGAAGGTTTTGCCGAT
GCGGATGGAAACATGGCAGAGGATCGACATGCTATTTCAGGTTTCGCGTTCATCATCAACGGTGGTGCCGTTTCA
TGGAGTGCGAAACGTCAGGAAATTGTTACCCTGTCCACAACGGAATCAGAGTACGTAGCTGTCACTCATGCTACC
AAAGAAGCCTTGTGGCTTCGTTCTCTCATCTCGCAGATTTTCGGAGCAATCCTTCCCACCACACCACTTTTCTCC
GACAATCAATCCGCTATTGCGCTTACAAAAGACCATAAGTATCATGGTCGCACAAAACATATCGACATACGGTAC
CACTTTATTCGATGGATCGTCGAAGAAGGAAAAGTCCGCCTGGTTTATTGTCCCACTGCGGACATGATTGCGGAT
ACATTGACAAAAGCTTTACCATCTCCAAAGGTAAAGCATTTCGCATCTGCGTTAGGCCTCGCCACGGTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail