Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|611100
Gene name
Locationscaffold_03b:553835..555013
Strand+
Gene length (bp)1178
Transcript length (bp)921
Coding sequence length (bp)921
Protein length (aa) 307

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP) 1.5E-32 131 212
PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP) 2.0E-31 220 302

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P17871|TBP_SCHPO TATA-box-binding protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tbp1 PE=3 SV=1 125 305 2.0E-117
sp|Q12731|TBP_EMENI TATA-box-binding protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tbpA PE=2 SV=1 55 305 1.0E-114
sp|P13393|TBP_YEAST TATA-box-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPT15 PE=1 SV=3 120 305 2.0E-114
sp|O43133|TBP_CANAL TATA-box-binding protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TBP1 PE=2 SV=1 130 305 2.0E-112
sp|P93348|TBP_TOBAC TATA-box-binding protein OS=Nicotiana tabacum PE=2 SV=1 128 305 2.0E-110
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P17871|TBP_SCHPO TATA-box-binding protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tbp1 PE=3 SV=1 125 305 2.0E-117
sp|Q12731|TBP_EMENI TATA-box-binding protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tbpA PE=2 SV=1 55 305 1.0E-114
sp|P13393|TBP_YEAST TATA-box-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPT15 PE=1 SV=3 120 305 2.0E-114
sp|O43133|TBP_CANAL TATA-box-binding protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TBP1 PE=2 SV=1 130 305 2.0E-112
sp|P93348|TBP_TOBAC TATA-box-binding protein OS=Nicotiana tabacum PE=2 SV=1 128 305 2.0E-110
sp|Q42808|TBP_SOYBN TATA-box-binding protein OS=Glycine max GN=TBP1 PE=2 SV=1 111 305 3.0E-110
sp|P50158|TBP1_MAIZE TATA-box-binding protein 1 OS=Zea mays GN=TBP1 PE=2 SV=1 128 305 3.0E-109
sp|P48511|TBP_MESCR TATA-box-binding protein OS=Mesembryanthemum crystallinum PE=2 SV=1 128 305 3.0E-109
sp|P50159|TBP2_MAIZE TATA-box-binding protein 2 OS=Zea mays GN=TBP2 PE=2 SV=1 128 305 4.0E-109
sp|P53361|TBP_SPOFR TATA-box-binding protein OS=Spodoptera frugiperda GN=Tbp PE=2 SV=1 82 305 2.0E-108
sp|Q8W0W4|TBP2_ORYSJ TATA-binding protein 2 OS=Oryza sativa subsp. japonica GN=TBP2 PE=1 SV=2 128 305 2.0E-108
sp|Q02879|TBP2_WHEAT TATA-box-binding protein 2 OS=Triticum aestivum GN=TBP2 PE=2 SV=1 111 305 5.0E-108
sp|P26357|TBP_SOLTU TATA-box-binding protein OS=Solanum tuberosum GN=TBP PE=2 SV=1 111 305 9.0E-108
sp|O45211|TBP_BOMMO TATA-box-binding protein OS=Bombyx mori GN=Tbp PE=2 SV=1 82 305 3.0E-107
sp|P26356|TBP1_WHEAT TATA-box-binding protein 1 OS=Triticum aestivum GN=TBP1 PE=2 SV=1 128 305 8.0E-107
sp|P91809|TBP_STRPU TATA-box-binding protein OS=Strongylocentrotus purpuratus PE=2 SV=1 110 305 1.0E-106
sp|P28148|TBP2_ARATH TATA-box-binding protein 2 OS=Arabidopsis thaliana GN=TBP2 PE=1 SV=1 128 305 4.0E-106
sp|P28147|TBP1_ARATH TATA-box-binding protein 1 OS=Arabidopsis thaliana GN=TBP1 PE=1 SV=1 128 305 5.0E-106
sp|P26354|TBP_ACACA TATA-box-binding protein OS=Acanthamoeba castellanii GN=TFIID PE=2 SV=1 128 305 1.0E-105
sp|O17488|TBP_ARTSF TATA-box-binding protein OS=Artemia franciscana PE=2 SV=1 84 305 1.0E-105
sp|Q7SXL3|TBP_DANRE TATA-box-binding protein OS=Danio rerio GN=tbp PE=1 SV=1 26 305 2.0E-103
sp|Q92117|TBP_PROFL TATA-box-binding protein OS=Protobothrops flavoviridis GN=TBP PE=3 SV=1 100 305 1.0E-102
sp|Q92146|TBP_TRIGA TATA-box-binding protein OS=Trimeresurus gramineus GN=TBP PE=3 SV=1 100 305 1.0E-102
sp|O13270|TBP_CHICK TATA-box-binding protein OS=Gallus gallus GN=TBP PE=2 SV=1 100 305 2.0E-102
sp|P53360|TBP_MESAU TATA-box-binding protein OS=Mesocricetus auratus GN=TBP PE=2 SV=1 100 305 2.0E-102
sp|P29037|TBP_MOUSE TATA-box-binding protein OS=Mus musculus GN=Tbp PE=1 SV=1 100 305 2.0E-102
sp|P20227|TBP_DROME TATA-box-binding protein OS=Drosophila melanogaster GN=Tbp PE=1 SV=1 124 305 3.0E-102
sp|Q28GG8|TBP_XENTR TATA-box-binding protein OS=Xenopus tropicalis GN=tbp PE=2 SV=1 100 305 3.0E-102
sp|Q2HJ52|TBP_BOVIN TATA-box-binding protein OS=Bos taurus GN=TBP PE=2 SV=1 100 305 6.0E-102
sp|Q4R4F5|TBP_MACFA TATA-box-binding protein OS=Macaca fascicularis GN=TBP PE=2 SV=1 100 305 6.0E-102
sp|P27633|TBP_XENLA TATA-box-binding protein OS=Xenopus laevis GN=tbp PE=1 SV=1 100 305 7.0E-102
sp|P20226|TBP_HUMAN TATA-box-binding protein OS=Homo sapiens GN=TBP PE=1 SV=2 100 305 9.0E-102
sp|A6H907|TBPL2_PANTR TATA box-binding protein-like protein 2 OS=Pan troglodytes GN=TBPL2 PE=2 SV=1 123 305 4.0E-101
sp|Q5UE94|TBPL2_XENLA TATA box-binding protein-like protein 2 OS=Xenopus laevis GN=tbpl2 PE=2 SV=1 128 305 2.0E-100
sp|P46272|TBP_ACEPE TATA-box-binding protein OS=Acetabularia peniculus PE=2 SV=1 128 305 2.0E-100
sp|Q28DH2|TBPL2_XENTR TATA box-binding protein-like protein 2 OS=Xenopus tropicalis GN=tbpl2 PE=2 SV=1 128 305 6.0E-100
sp|Q6SJ96|TBPL2_HUMAN TATA box-binding protein-like protein 2 OS=Homo sapiens GN=TBPL2 PE=2 SV=1 123 305 9.0E-99
sp|Q1JPY4|TBPL2_DANRE TATA box-binding protein-like protein 2 OS=Danio rerio GN=tbpl2 PE=1 SV=1 128 305 1.0E-98
sp|Q6SJ94|TBPL2_TAKRU TATA box-binding protein-like protein 2 OS=Takifugu rubripes GN=tbpl2 PE=2 SV=1 123 305 3.0E-96
sp|P26355|TBP_DICDI TATA-box-binding protein OS=Dictyostelium discoideum GN=tbpA PE=2 SV=2 128 305 4.0E-96
sp|P32085|TBP_CAEEL TATA-box-binding protein OS=Caenorhabditis elegans GN=tbp-1 PE=2 SV=1 100 305 4.0E-95
sp|Q9NHP5|TBP_DROVI TATA-box-binding protein OS=Drosophila virilis GN=Tbp PE=3 SV=1 124 305 4.0E-95
sp|A6H909|TBPL2_RAT TATA box-binding protein-like protein 2 OS=Rattus norvegicus GN=Tbpl2 PE=2 SV=1 123 305 4.0E-93
sp|Q6SJ95|TBPL2_MOUSE TATA box-binding protein-like protein 2 OS=Mus musculus GN=Tbpl2 PE=1 SV=1 109 305 2.0E-90
sp|Q27850|TBP_TETTH TATA-box-binding protein OS=Tetrahymena thermophila PE=3 SV=1 117 305 1.0E-85
sp|Q27896|TRF_DROME TBP-related factor OS=Drosophila melanogaster GN=Trf PE=2 SV=1 80 305 7.0E-73
sp|A7UFC2|TBPL1_ENTHI TATA-box-binding protein-like protein 1 OS=Entamoeba histolytica GN=trf1 PE=3 SV=1 131 302 1.0E-70
sp|C4M7H7|TBP2_ENTHI TATA-box-binding protein 2 OS=Entamoeba histolytica GN=EHI_112050 PE=3 SV=1 131 305 4.0E-56
sp|P52653|TBP1_ENTHI TATA-box-binding protein 1 OS=Entamoeba histolytica GN=TBP PE=3 SV=2 131 305 8.0E-56
sp|P32086|TBP_PLAFA TATA-box-binding protein OS=Plasmodium falciparum GN=TBP PE=3 SV=1 127 304 5.0E-44
sp|P58177|TBP_PYROC TATA-box-binding protein OS=Pyrodictium occultum GN=tbp PE=3 SV=1 132 304 3.0E-43
sp|Q8ZVR0|TBP_PYRAE TATA-box-binding protein OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=tbp PE=3 SV=1 133 303 4.0E-42
sp|A3MV36|TBP_PYRCJ TATA-box-binding protein OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=tbp PE=3 SV=1 133 303 3.0E-41
sp|B1Y949|TBP_PYRNV TATA-box-binding protein OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=tbp PE=3 SV=1 133 303 5.0E-41
sp|A1RSQ1|TBP_PYRIL TATA-box-binding protein OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=tbp PE=3 SV=1 133 303 2.0E-40
sp|Q971V3|TBP_SULTO TATA-box-binding protein OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=tbp PE=3 SV=2 130 303 4.0E-40
sp|Q9UWN7|TBP_SULAC TATA-box-binding protein OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=tbp PE=1 SV=1 130 303 6.0E-40
sp|Q55031|TBP_SULSH TATA-box-binding protein OS=Sulfolobus shibatae GN=tbp PE=1 SV=2 130 303 3.0E-37
sp|P58178|TBP_SULSO TATA-box-binding protein OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=tbp PE=3 SV=1 130 303 5.0E-37
sp|Q9YAT1|TBP_AERPE TATA-box-binding protein OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=tbp PE=3 SV=3 124 302 2.0E-36
sp|Q5U385|TBPL1_DANRE TATA box-binding protein-like protein 1 OS=Danio rerio GN=tbpl1 PE=2 SV=1 135 305 2.0E-35
sp|O27664|TBP_METTH TATA-box-binding protein OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=tbp PE=3 SV=1 133 288 2.0E-35
sp|O29874|TBP_ARCFU TATA-box-binding protein OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=tbp PE=3 SV=1 133 296 2.0E-35
sp|A6VIP7|TBP_METM7 TATA-box-binding protein OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=tbp PE=3 SV=1 135 305 3.0E-35
sp|Q6DIY4|TBPL1_XENTR TATA box-binding protein-like protein 1 OS=Xenopus tropicalis GN=tbpl1 PE=2 SV=1 133 305 5.0E-35
sp|Q5V470|TBP_HALMA TATA-box-binding protein OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=tbp PE=3 SV=1 133 303 7.0E-35
sp|Q9W6Z2|TBPL1_XENLA TATA box-binding protein-like protein 1 OS=Xenopus laevis GN=tbpl1 PE=2 SV=1 133 305 9.0E-35
sp|Q9P9I9|TBP_METTL TATA-box-binding protein OS=Methanothermococcus thermolithotrophicus GN=tbp PE=3 SV=1 135 305 1.0E-34
sp|A5UL47|TBP_METS3 TATA-box-binding protein OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=tbp PE=3 SV=1 133 303 2.0E-34
sp|A0B5H8|TBP_METTP TATA-box-binding protein OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=tbp PE=3 SV=1 132 288 2.0E-34
sp|A6UTF6|TBP_META3 TATA-box-binding protein OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=tbp PE=3 SV=1 135 305 2.0E-33
sp|C6A0R1|TBP_THESM TATA-box-binding protein OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=tbp PE=3 SV=1 133 296 2.0E-33
sp|Q5R7U8|TBPL1_PONAB TATA box-binding protein-like protein 1 OS=Pongo abelii GN=TBPL1 PE=2 SV=1 133 305 3.0E-33
sp|P62340|TBPL1_MOUSE TATA box-binding protein-like protein 1 OS=Mus musculus GN=Tbpl1 PE=1 SV=1 133 305 4.0E-33
sp|Q4R848|TBPL1_MACFA TATA box-binding protein-like protein 1 OS=Macaca fascicularis GN=TBPL1 PE=2 SV=1 133 305 4.0E-33
sp|P62380|TBPL1_HUMAN TATA box-binding protein-like protein 1 OS=Homo sapiens GN=TBPL1 PE=1 SV=1 133 305 4.0E-33
sp|Q32LB1|TBPL1_BOVIN TATA box-binding protein-like protein 1 OS=Bos taurus GN=TBPL1 PE=2 SV=1 133 305 4.0E-33
sp|Q56253|TBP_THECE TATA-box-binding protein OS=Thermococcus celer GN=tbp PE=3 SV=1 133 305 5.0E-33
sp|Q9YGV8|TBPL1_CHICK TATA box-binding protein-like protein 1 OS=Gallus gallus GN=TBPL1 PE=2 SV=1 133 305 5.0E-33
sp|D4H071|TBP2_HALVD TATA-box-binding protein 2 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=tbp2 PE=1 SV=1 133 296 7.0E-33
sp|Q6M0L3|TBP_METMP TATA-box-binding protein OS=Methanococcus maripaludis (strain S2 / LL) GN=tbp PE=3 SV=1 135 305 9.0E-33
sp|B6YXI6|TBP_THEON TATA-box-binding protein OS=Thermococcus onnurineus (strain NA1) GN=tbp PE=3 SV=1 133 292 1.0E-32
sp|Q52366|TBP_THEKO TATA-box-binding protein OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=tbp PE=3 SV=1 133 292 1.0E-32
sp|Q9HN56|TBPE_HALSA TATA-box-binding protein E OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=tbpE PE=3 SV=1 132 303 1.0E-32
sp|A6URP5|TBP_METVS TATA-box-binding protein OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=tbp PE=3 SV=1 135 305 2.0E-32
sp|Q57930|TBP_METJA TATA-box-binding protein OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=tbp PE=1 SV=1 135 305 4.0E-32
sp|Q2NFC3|TBP_METST TATA-box-binding protein OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=tbp PE=3 SV=1 133 284 5.0E-32
sp|O58737|TBP_PYRHO TATA-box-binding protein OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=tbp PE=3 SV=1 133 292 8.0E-32
sp|A9A840|TBP_METM6 TATA-box-binding protein OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=tbp PE=3 SV=1 135 305 1.0E-31
sp|Q3ITB1|TBP_NATPD TATA-box-binding protein OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=tbp PE=3 SV=1 132 303 1.0E-31
sp|Q6L1R1|TBP_PICTO TATA-box-binding protein OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=tbp PE=3 SV=1 132 292 2.0E-31
sp|Q9V024|TBP_PYRAB TATA-box-binding protein OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=tbp PE=3 SV=1 133 292 3.0E-31
sp|Q978J5|TBP_THEVO TATA-box-binding protein OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=tbp PE=3 SV=1 132 292 4.0E-31
sp|Q8TTZ7|TBP3_METAC TATA-box-binding protein 3 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=tbp3 PE=3 SV=1 132 288 4.0E-31
sp|D4GZA2|TBP1_HALVD TATA-box-binding protein 1 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=tbp1 PE=3 SV=1 132 303 4.0E-31
sp|Q9HLM8|TBP_THEAC TATA-box-binding protein OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=tbp PE=3 SV=1 132 292 9.0E-31
sp|P62001|TBP_PYRWO TATA-box-binding protein OS=Pyrococcus woesei GN=tbp PE=1 SV=1 133 300 1.0E-30
sp|P62000|TBP_PYRFU TATA-box-binding protein OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=tbp PE=3 SV=1 133 300 1.0E-30
sp|O52018|TBPD_HALSA TATA-box-binding protein D OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=tbpD PE=3 SV=1 133 303 2.0E-30
sp|Q48325|TBPB_HALSA TATA-box-binding protein B OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=tbpB1 PE=3 SV=1 133 303 7.0E-30
sp|Q8PY36|TBP2_METMA TATA-box-binding protein 2 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=tbp2 PE=3 SV=1 133 296 1.0E-29
sp|Q9HHE9|TBPF_HALSA TATA-box-binding protein F OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=tbpF PE=3 SV=1 133 283 2.0E-29
sp|Q8TU94|TBP2_METAC TATA-box-binding protein 2 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=tbp2 PE=3 SV=1 132 300 3.0E-29
sp|Q8TI26|TBP1_METAC TATA-box-binding protein 1 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=tbp1 PE=3 SV=1 133 284 3.0E-29
sp|Q8PUZ4|TBP3_METMA TATA-box-binding protein 3 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=tbp3 PE=3 SV=1 132 298 7.0E-28
sp|Q8PY37|TBP1_METMA TATA-box-binding protein 1 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=tbp1 PE=3 SV=1 133 284 9.0E-28
sp|Q8TX38|TBP_METKA TATA-box-binding protein OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=tbp PE=3 SV=1 133 288 5.0E-26
sp|O52004|TBPC_HALSA TATA-box-binding protein C OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=tbpC1 PE=3 SV=1 133 293 9.0E-18
sp|O27664|TBP_METTH TATA-box-binding protein OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=tbp PE=3 SV=1 133 210 2.0E-14
sp|Q57930|TBP_METJA TATA-box-binding protein OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=tbp PE=1 SV=1 118 212 4.0E-14
sp|Q2NFC3|TBP_METST TATA-box-binding protein OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=tbp PE=3 SV=1 133 204 8.0E-14
sp|P58178|TBP_SULSO TATA-box-binding protein OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=tbp PE=3 SV=1 120 213 1.0E-13
sp|B6YXI6|TBP_THEON TATA-box-binding protein OS=Thermococcus onnurineus (strain NA1) GN=tbp PE=3 SV=1 133 214 1.0E-13
sp|O29874|TBP_ARCFU TATA-box-binding protein OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=tbp PE=3 SV=1 133 214 2.0E-13
sp|C6A0R1|TBP_THESM TATA-box-binding protein OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=tbp PE=3 SV=1 133 214 2.0E-13
sp|Q3ITB1|TBP_NATPD TATA-box-binding protein OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=tbp PE=3 SV=1 132 214 2.0E-13
sp|Q9V024|TBP_PYRAB TATA-box-binding protein OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=tbp PE=3 SV=1 133 214 2.0E-13
sp|Q8ZVR0|TBP_PYRAE TATA-box-binding protein OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=tbp PE=3 SV=1 133 213 4.0E-13
sp|Q8TX38|TBP_METKA TATA-box-binding protein OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=tbp PE=3 SV=1 133 214 4.0E-13
sp|Q52366|TBP_THEKO TATA-box-binding protein OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=tbp PE=3 SV=1 133 221 6.0E-13
sp|P62001|TBP_PYRWO TATA-box-binding protein OS=Pyrococcus woesei GN=tbp PE=1 SV=1 133 213 6.0E-13
sp|P62000|TBP_PYRFU TATA-box-binding protein OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=tbp PE=3 SV=1 133 213 6.0E-13
sp|Q6L1R1|TBP_PICTO TATA-box-binding protein OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=tbp PE=3 SV=1 133 214 7.0E-13
sp|A3MV36|TBP_PYRCJ TATA-box-binding protein OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=tbp PE=3 SV=1 133 213 1.0E-12
sp|A1RSQ1|TBP_PYRIL TATA-box-binding protein OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=tbp PE=3 SV=1 133 213 1.0E-12
sp|O58737|TBP_PYRHO TATA-box-binding protein OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=tbp PE=3 SV=1 133 214 1.0E-12
sp|B1Y949|TBP_PYRNV TATA-box-binding protein OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=tbp PE=3 SV=1 133 213 2.0E-12
sp|Q9HLM8|TBP_THEAC TATA-box-binding protein OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=tbp PE=3 SV=1 133 214 4.0E-12
sp|Q8TI26|TBP1_METAC TATA-box-binding protein 1 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=tbp1 PE=3 SV=1 132 199 4.0E-12
sp|A0B5H8|TBP_METTP TATA-box-binding protein OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=tbp PE=3 SV=1 133 214 5.0E-12
sp|Q978J5|TBP_THEVO TATA-box-binding protein OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=tbp PE=3 SV=1 133 214 5.0E-12
sp|Q8PY36|TBP2_METMA TATA-box-binding protein 2 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=tbp2 PE=3 SV=1 132 199 9.0E-12
sp|Q9HN56|TBPE_HALSA TATA-box-binding protein E OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=tbpE PE=3 SV=1 132 214 1.0E-11
sp|Q8TTZ7|TBP3_METAC TATA-box-binding protein 3 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=tbp3 PE=3 SV=1 133 214 1.0E-11
sp|D4H071|TBP2_HALVD TATA-box-binding protein 2 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=tbp2 PE=1 SV=1 132 214 2.0E-11
sp|Q8PY37|TBP1_METMA TATA-box-binding protein 1 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=tbp1 PE=3 SV=1 132 199 2.0E-11
sp|D4H071|TBP2_HALVD TATA-box-binding protein 2 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=tbp2 PE=1 SV=1 221 306 3.0E-11
sp|Q8TX38|TBP_METKA TATA-box-binding protein OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=tbp PE=3 SV=1 221 296 3.0E-11
sp|D4GZA2|TBP1_HALVD TATA-box-binding protein 1 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=tbp1 PE=3 SV=1 221 306 4.0E-11
sp|Q56253|TBP_THECE TATA-box-binding protein OS=Thermococcus celer GN=tbp PE=3 SV=1 221 300 7.0E-11
sp|Q5V470|TBP_HALMA TATA-box-binding protein OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=tbp PE=3 SV=1 132 214 8.0E-11
sp|B6YXI6|TBP_THEON TATA-box-binding protein OS=Thermococcus onnurineus (strain NA1) GN=tbp PE=3 SV=1 215 300 1.0E-10
sp|Q9HHE9|TBPF_HALSA TATA-box-binding protein F OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=tbpF PE=3 SV=1 221 303 2.0E-10
sp|C6A0R1|TBP_THESM TATA-box-binding protein OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=tbp PE=3 SV=1 220 300 4.0E-10
sp|A6URP5|TBP_METVS TATA-box-binding protein OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=tbp PE=3 SV=1 118 212 4.0E-09
sp|Q6L1R1|TBP_PICTO TATA-box-binding protein OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=tbp PE=3 SV=1 216 296 5.0E-09
sp|Q8TU94|TBP2_METAC TATA-box-binding protein 2 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=tbp2 PE=3 SV=1 133 214 6.0E-09
sp|Q52366|TBP_THEKO TATA-box-binding protein OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=tbp PE=3 SV=1 221 300 1.0E-08
sp|Q9HHE9|TBPF_HALSA TATA-box-binding protein F OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=tbpF PE=3 SV=1 133 214 1.0E-08
sp|Q8PUZ4|TBP3_METMA TATA-box-binding protein 3 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=tbp3 PE=3 SV=1 219 302 8.0E-08
sp|A0B5H8|TBP_METTP TATA-box-binding protein OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=tbp PE=3 SV=1 219 300 2.0E-07
sp|O29874|TBP_ARCFU TATA-box-binding protein OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=tbp PE=3 SV=1 220 303 3.0E-07
sp|O52004|TBPC_HALSA TATA-box-binding protein C OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=tbpC1 PE=3 SV=1 132 212 3.0E-07
sp|Q8PY36|TBP2_METMA TATA-box-binding protein 2 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=tbp2 PE=3 SV=1 219 296 4.0E-07
sp|Q8TI26|TBP1_METAC TATA-box-binding protein 1 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=tbp1 PE=3 SV=1 219 296 4.0E-07
sp|Q8PY37|TBP1_METMA TATA-box-binding protein 1 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=tbp1 PE=3 SV=1 219 296 2.0E-06
sp|Q8TTZ7|TBP3_METAC TATA-box-binding protein 3 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=tbp3 PE=3 SV=1 219 284 3.0E-06
sp|O74045|TBP_CENSY TATA-box-binding protein OS=Cenarchaeum symbiosum (strain A) GN=tbp PE=3 SV=1 129 202 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0006352 DNA-templated transcription, initiation Yes
GO:1901360 organic cyclic compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:1901576 organic substance biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0003676 nucleic acid binding No
GO:0044249 cellular biosynthetic process No
GO:0008152 metabolic process No
GO:0032774 RNA biosynthetic process No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0097159 organic cyclic compound binding No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0016070 RNA metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:0044237 cellular metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0043170 macromolecule metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|611100
MSFALPARQVTFSRPNTQQQPYQPPQQPQYQPPQAHGLALPSGNAYNAPVQSSSGIALPGPSPLSNSYVPPQPTQ
HSQAVANKLSPTQQTGSSTTAVAGPSTSTAGTPVPSTPVPLTLEQQHITAVEGIVPTLQNIVATVNLDCRLDLKT
IALHARNAEYNPKRFAAVIMRIRDPKTTALIFASGKMVVTGAKSEDDSRLASRKYARIVQKLGFDAKFSEFKIQN
IVGSCDVKFPIRLEGLAYSHGQFSSYEPELFPGLIYRMIKPKVVLLIFVSGKIVLTGAKVREEIYTAFNTIYTVL
CEFRKP*
Coding >Agabi119p4|611100
ATGTCTTTCGCGTTGCCCGCCCGCCAAGTCACCTTTTCCCGCCCCAATACTCAGCAGCAGCCGTACCAGCCGCCG
CAACAGCCCCAGTATCAGCCGCCGCAGGCTCATGGCTTGGCTCTTCCGTCGGGGAACGCGTATAATGCTCCAGTC
CAGTCTAGTTCTGGCATAGCATTGCCGGGGCCTTCGCCACTTTCCAACTCTTATGTTCCTCCTCAACCGACTCAG
CACTCTCAAGCCGTCGCGAACAAGCTTTCTCCTACTCAGCAGACTGGTTCGTCAACCACGGCTGTTGCTGGTCCA
TCGACGTCGACTGCTGGGACGCCAGTGCCCTCGACGCCGGTGCCTCTTACTCTCGAGCAGCAACATATTACCGCG
GTCGAGGGTATCGTGCCTACTCTCCAGAACATCGTTGCCACAGTCAACTTGGACTGTCGACTGGACCTAAAGACG
ATCGCCCTTCACGCCAGGAATGCTGAATACAACCCTAAGCGTTTCGCGGCCGTCATTATGCGAATTCGTGATCCG
AAGACAACCGCCCTCATCTTTGCGTCGGGCAAGATGGTCGTGACGGGCGCGAAGTCGGAGGACGATTCGCGTCTG
GCGTCGCGTAAATACGCGCGTATCGTGCAGAAATTGGGCTTTGACGCCAAATTCTCTGAGTTCAAGATACAAAAC
ATTGTGGGCAGTTGCGATGTCAAGTTCCCTATTCGACTTGAGGGTCTTGCATACTCCCATGGACAGTTCAGCAGT
TACGAACCTGAGCTGTTCCCTGGCTTAATCTATCGCATGATCAAGCCGAAGGTTGTGCTGCTCATCTTCGTCTCG
GGAAAGATTGTCTTAACCGGCGCCAAGGTCCGAGAGGAGATTTATACTGCCTTCAACACGATCTATACTGTCTTG
TGTGAATTCCGCAAGCCGTGA
Transcript >Agabi119p4|611100
ATGTCTTTCGCGTTGCCCGCCCGCCAAGTCACCTTTTCCCGCCCCAATACTCAGCAGCAGCCGTACCAGCCGCCG
CAACAGCCCCAGTATCAGCCGCCGCAGGCTCATGGCTTGGCTCTTCCGTCGGGGAACGCGTATAATGCTCCAGTC
CAGTCTAGTTCTGGCATAGCATTGCCGGGGCCTTCGCCACTTTCCAACTCTTATGTTCCTCCTCAACCGACTCAG
CACTCTCAAGCCGTCGCGAACAAGCTTTCTCCTACTCAGCAGACTGGTTCGTCAACCACGGCTGTTGCTGGTCCA
TCGACGTCGACTGCTGGGACGCCAGTGCCCTCGACGCCGGTGCCTCTTACTCTCGAGCAGCAACATATTACCGCG
GTCGAGGGTATCGTGCCTACTCTCCAGAACATCGTTGCCACAGTCAACTTGGACTGTCGACTGGACCTAAAGACG
ATCGCCCTTCACGCCAGGAATGCTGAATACAACCCTAAGCGTTTCGCGGCCGTCATTATGCGAATTCGTGATCCG
AAGACAACCGCCCTCATCTTTGCGTCGGGCAAGATGGTCGTGACGGGCGCGAAGTCGGAGGACGATTCGCGTCTG
GCGTCGCGTAAATACGCGCGTATCGTGCAGAAATTGGGCTTTGACGCCAAATTCTCTGAGTTCAAGATACAAAAC
ATTGTGGGCAGTTGCGATGTCAAGTTCCCTATTCGACTTGAGGGTCTTGCATACTCCCATGGACAGTTCAGCAGT
TACGAACCTGAGCTGTTCCCTGGCTTAATCTATCGCATGATCAAGCCGAAGGTTGTGCTGCTCATCTTCGTCTCG
GGAAAGATTGTCTTAACCGGCGCCAAGGTCCGAGAGGAGATTTATACTGCCTTCAACACGATCTATACTGTCTTG
TGTGAATTCCGCAAGCCGTGA
Gene >Agabi119p4|611100
ATGTCTTTCGCGTTGCCCGCCCGCCAAGTCACCTTTTCCCGCCCCAATACTCAGCAGCAGCCGTACCAGCCGCCG
CAACAGCCCCAGTATCAGCCGCCGCAGGCTCATGGCTTGGCTCTTCCGTCGGGGAACGCGTATAATGCTCCAGTC
CAGTCTAGTTCTGGCATAGCATTGCCGGGGCCTTCGCCACTTTCCAACTCTTATGTTCCTCCTCAACCGACTCAG
CACTCTCAAGCCGTCGCGAACAAGCTTTCTCCTACTCAGCAGACTGGTTCGTCAACCACGGCTGTTGCTGGTCCA
TCGACGTCGACTGCTGGGACGCCAGTGCCCTCGACGCCGGTGCCTCTTACTCTCGAGCAGCAACATATTACCGCG
GTCGAGGGTATCGTGCCTACTCTCCAGAACATCGTTGCCACAGTCAACTTGGACTGTCGACTGGACCTAAAGACG
ATCGCCCTTCACGCCAGGAATGCTGAATACAACCCTAAGGTTTGTACATGATCCCTAAGCTTATAATGTATGGCA
AAGTCGAACTGCTCGATATTTGCATGATTATAGCGTTTCGCGGCCGTCATTATGCGAATTCGTGATCCGAAGACA
ACCGCCCTCATCTTTGCGTCGGGCAAGATGGTCGTGACGGGCGCGAAGTCGGAGGACGATTCGCGTCTGGCGTCG
CGTAAATACGCGCGTATCGTGCAGAAATTGGGCTTTGACGCCAAATTCTCTGAGTTCAAGATACAAAACATTGTG
GGCAGTTGCGATGTCAAGTTCCCTATTCGACTTGAGGGTCTTGCATACTCCCATGGACAGTTCAGCAGTTACGAA
CCTGAGGTACGGCAGCCTATCATGTCTTTGAATATGATGTTGAACGTATTCTTAGCTGTTCCCTGGCTTAATCTA
TCGCATGATCAAGCCGAAGGTTGTGCTGCTCATCTTCGTCTCGGGAAAGATTGTCTTAACCGGCGCCAAGGTGAA
TCATCTTTTTTTCTTCTCTTTTCCCATGATCAGAGCCTCGCGGCTCTGTTCACCCTGCGGATAATCCCCGCATAA
TCTGGATTGTCTCCTGCAACCTGAGATCAGCTTGCTGACACCGCTTCCGTGACCATCAGGTCCGAGAGGAGATTT
ATACTGCCTTCAACACGATCTATACTGTCTTGTGTGAATTCCGCAAGCCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail