Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|611000
Gene name
Locationscaffold_03b:540580..543042
Strand-
Gene length (bp)2462
Transcript length (bp)2346
Coding sequence length (bp)2346
Protein length (aa) 782

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00538 Linker_histone linker histone H1 and H5 family 7.1E-06 321 388

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0006334 nucleosome assembly Yes
GO:0000786 nucleosome Yes
GO:0071840 cellular component organization or biogenesis No
GO:0065003 protein-containing complex assembly No
GO:0003674 molecular_function No
GO:0022607 cellular component assembly No
GO:0034728 nucleosome organization No
GO:0044815 DNA packaging complex No
GO:0003676 nucleic acid binding No
GO:0032991 protein-containing complex No
GO:0071824 protein-DNA complex subunit organization No
GO:0032993 protein-DNA complex No
GO:0005488 binding No
GO:0006338 chromatin remodeling No
GO:0097159 organic cyclic compound binding No
GO:0005575 cellular_component No
GO:0009987 cellular process No
GO:0065004 protein-DNA complex assembly No
GO:0006325 chromatin organization No
GO:1901363 heterocyclic compound binding No
GO:0043933 protein-containing complex organization No
GO:0008150 biological_process No
GO:0016043 cellular component organization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|611000
MQAASSSYLPPHPLSPPPPPQPPQSYYQGLYHIQSLGPQDHELKRQYLGLLETKQVIEICLMLDVYVAPYVRGMI
WPQDLGAAITGLRKSTTSNGASTAAGVGASAATTTTSNDDDDASVSTTRSGRKEGEEEPVMASLDGLKEGSGGRV
VENGERVEKASQEVTKTAATTTEMETAPMSGLAQVSTSSTGASATPALTSSTPAPTSSTPAPASAAPAPAPNQQQ
PPYPHQPYGYPQHPTAAYPHAPYYPPPPPGYPSYPPSSYPHYPPPPNGYPTAPGGYPLPYSTPSSHPHQQSFPHL
HPPPPHPQSHVHQEQTPDEIPSYEEMIVEALQESASADPEGCAPKDLFSWMAARYPLQSNFRPSASQALQKAFKR
GRLEKSSNGKYRLSGTWEGGSTSRRTTRRPQMQQHSQPNAMVPPSASSSHPQLPPSGSPFTHAPLVHHHHHNTHA
SAYPYAYGYPGYPQIHPGQQQQPSTTDNSVTKNTTGDKTTIAAATSDESDKDAYEAAQNILKAINFGDLLQISQT
EEGGNNVNNKGGGAAGGGDAGEVSMDQLTSLLIQAQHAISGQRQSMEGQQQQQQQQQQQQQQVAGALTSSLHGGV
ITPLPTLSATAGVAVASSTSTSNGAAASTSTQLNGTSLATTMGVGQTMNVRAELQAQLALLAVQLAELGQEGENG
GGGNGVVEQLLQSQNGMTVVGSRNEENGIEGAVTQRVITPPMNGLVPLSLDSNPNPNPNTISSGVEGTKSVSASA
LESQTRLGKERKGDDDDDSLIDPLYEMRVWW*
Coding >Agabi119p4|611000
ATGCAGGCTGCCAGCTCGTCTTATCTTCCTCCTCATCCTCTATCACCCCCACCCCCACCACAACCTCCACAATCG
TATTACCAAGGATTATATCATATACAGTCTCTTGGACCGCAGGATCATGAACTTAAGAGACAATATCTGGGTTTG
TTGGAGACGAAACAGGTTATTGAGATATGTTTGATGTTGGATGTGTATGTGGCGCCGTATGTGAGAGGTATGATT
TGGCCTCAGGATTTGGGGGCTGCGATTACTGGGTTGAGGAAATCGACGACGAGTAATGGTGCTTCTACTGCTGCT
GGTGTTGGTGCTAGTGCTGCGACTACGACGACGAGTAATGATGATGATGATGCTTCGGTGTCTACGACTAGGTCG
GGGAGGAAGGAGGGGGAGGAGGAACCTGTGATGGCTTCGTTGGATGGATTGAAGGAAGGATCTGGTGGTCGTGTT
GTGGAAAATGGTGAGAGGGTGGAGAAAGCATCGCAGGAGGTAACAAAAACAGCGGCGACGACGACGGAGATGGAG
ACGGCGCCGATGAGTGGACTTGCTCAGGTATCGACATCATCAACGGGTGCATCTGCTACGCCTGCGCTTACATCT
TCTACTCCTGCACCTACGTCTTCTACTCCTGCTCCTGCGTCTGCTGCTCCTGCTCCTGCTCCCAATCAGCAACAG
CCGCCTTATCCTCATCAGCCTTACGGTTATCCTCAACATCCTACGGCAGCCTATCCTCATGCACCATACTACCCA
CCACCTCCACCTGGTTATCCTTCCTATCCTCCGTCATCGTACCCTCATTATCCACCACCCCCTAACGGTTATCCC
ACCGCACCAGGAGGATATCCCCTCCCTTACTCAACTCCATCATCACACCCTCATCAACAATCATTTCCACATCTT
CATCCCCCTCCCCCTCATCCGCAGTCCCATGTTCATCAAGAACAAACTCCAGATGAAATACCTAGTTATGAAGAA
ATGATTGTTGAAGCGTTACAAGAATCTGCATCTGCAGATCCTGAAGGATGTGCACCTAAAGATCTGTTTTCGTGG
ATGGCGGCTAGGTATCCTTTGCAGTCGAATTTTAGGCCGTCGGCGAGTCAGGCTTTGCAGAAGGCTTTTAAGAGG
GGGAGGTTGGAGAAGAGTAGTAACGGAAAATATAGGTTGAGTGGGACTTGGGAAGGAGGAAGTACGTCGAGAAGA
ACGACGAGACGTCCGCAAATGCAACAGCATAGTCAACCTAATGCTATGGTACCACCATCGGCTTCGTCATCACAT
CCACAACTACCACCGTCTGGTTCACCGTTCACTCATGCTCCCCTTGTACACCATCACCATCATAATACGCATGCT
TCAGCGTATCCTTATGCTTATGGATATCCTGGATATCCTCAAATACATCCTGGACAACAACAACAACCATCTACA
ACAGATAATTCTGTTACGAAGAATACTACTGGAGATAAAACTACGATTGCTGCTGCGACGTCGGATGAATCGGAT
AAAGATGCATATGAAGCCGCTCAAAATATACTCAAGGCCATCAATTTCGGTGATTTATTACAAATTTCTCAAACT
GAAGAGGGGGGTAATAATGTTAATAATAAAGGAGGAGGAGCGGCGGGAGGAGGAGATGCGGGGGAAGTGTCGATG
GATCAACTTACGTCGTTGTTGATTCAAGCGCAACATGCTATTTCGGGTCAGAGGCAGTCTATGGAGGGACAACAA
CAACAACAACAACAACAACAACAACAACAACAACAGGTTGCGGGAGCTTTGACTTCGAGTTTGCATGGTGGAGTG
ATAACGCCGTTACCGACGTTGAGCGCTACGGCTGGTGTCGCTGTGGCTTCTTCTACTTCTACTTCTAATGGTGCT
GCTGCTTCTACGTCAACTCAGCTTAATGGAACGTCTTTGGCGACGACGATGGGGGTGGGGCAAACAATGAATGTA
CGTGCGGAATTGCAGGCTCAACTTGCGCTTTTGGCTGTGCAGTTGGCGGAATTGGGACAGGAAGGTGAGAATGGT
GGTGGTGGTAATGGAGTGGTTGAGCAACTTTTGCAAAGTCAAAATGGGATGACTGTTGTTGGGTCAAGGAATGAA
GAAAATGGTATTGAAGGAGCGGTGACGCAAAGAGTGATTACCCCGCCTATGAATGGTTTAGTACCTCTTTCTCTT
GATTCGAATCCGAATCCGAATCCGAATACCATTTCGTCGGGGGTGGAGGGAACAAAATCTGTTTCGGCATCGGCA
TTGGAATCTCAAACGCGGTTAGGGAAGGAAAGAAAGGGGGATGATGATGATGATAGTTTGATTGATCCTCTCTAC
GAAATGCGAGTGTGGTGGTAG
Transcript >Agabi119p4|611000
ATGCAGGCTGCCAGCTCGTCTTATCTTCCTCCTCATCCTCTATCACCCCCACCCCCACCACAACCTCCACAATCG
TATTACCAAGGATTATATCATATACAGTCTCTTGGACCGCAGGATCATGAACTTAAGAGACAATATCTGGGTTTG
TTGGAGACGAAACAGGTTATTGAGATATGTTTGATGTTGGATGTGTATGTGGCGCCGTATGTGAGAGGTATGATT
TGGCCTCAGGATTTGGGGGCTGCGATTACTGGGTTGAGGAAATCGACGACGAGTAATGGTGCTTCTACTGCTGCT
GGTGTTGGTGCTAGTGCTGCGACTACGACGACGAGTAATGATGATGATGATGCTTCGGTGTCTACGACTAGGTCG
GGGAGGAAGGAGGGGGAGGAGGAACCTGTGATGGCTTCGTTGGATGGATTGAAGGAAGGATCTGGTGGTCGTGTT
GTGGAAAATGGTGAGAGGGTGGAGAAAGCATCGCAGGAGGTAACAAAAACAGCGGCGACGACGACGGAGATGGAG
ACGGCGCCGATGAGTGGACTTGCTCAGGTATCGACATCATCAACGGGTGCATCTGCTACGCCTGCGCTTACATCT
TCTACTCCTGCACCTACGTCTTCTACTCCTGCTCCTGCGTCTGCTGCTCCTGCTCCTGCTCCCAATCAGCAACAG
CCGCCTTATCCTCATCAGCCTTACGGTTATCCTCAACATCCTACGGCAGCCTATCCTCATGCACCATACTACCCA
CCACCTCCACCTGGTTATCCTTCCTATCCTCCGTCATCGTACCCTCATTATCCACCACCCCCTAACGGTTATCCC
ACCGCACCAGGAGGATATCCCCTCCCTTACTCAACTCCATCATCACACCCTCATCAACAATCATTTCCACATCTT
CATCCCCCTCCCCCTCATCCGCAGTCCCATGTTCATCAAGAACAAACTCCAGATGAAATACCTAGTTATGAAGAA
ATGATTGTTGAAGCGTTACAAGAATCTGCATCTGCAGATCCTGAAGGATGTGCACCTAAAGATCTGTTTTCGTGG
ATGGCGGCTAGGTATCCTTTGCAGTCGAATTTTAGGCCGTCGGCGAGTCAGGCTTTGCAGAAGGCTTTTAAGAGG
GGGAGGTTGGAGAAGAGTAGTAACGGAAAATATAGGTTGAGTGGGACTTGGGAAGGAGGAAGTACGTCGAGAAGA
ACGACGAGACGTCCGCAAATGCAACAGCATAGTCAACCTAATGCTATGGTACCACCATCGGCTTCGTCATCACAT
CCACAACTACCACCGTCTGGTTCACCGTTCACTCATGCTCCCCTTGTACACCATCACCATCATAATACGCATGCT
TCAGCGTATCCTTATGCTTATGGATATCCTGGATATCCTCAAATACATCCTGGACAACAACAACAACCATCTACA
ACAGATAATTCTGTTACGAAGAATACTACTGGAGATAAAACTACGATTGCTGCTGCGACGTCGGATGAATCGGAT
AAAGATGCATATGAAGCCGCTCAAAATATACTCAAGGCCATCAATTTCGGTGATTTATTACAAATTTCTCAAACT
GAAGAGGGGGGTAATAATGTTAATAATAAAGGAGGAGGAGCGGCGGGAGGAGGAGATGCGGGGGAAGTGTCGATG
GATCAACTTACGTCGTTGTTGATTCAAGCGCAACATGCTATTTCGGGTCAGAGGCAGTCTATGGAGGGACAACAA
CAACAACAACAACAACAACAACAACAACAACAACAGGTTGCGGGAGCTTTGACTTCGAGTTTGCATGGTGGAGTG
ATAACGCCGTTACCGACGTTGAGCGCTACGGCTGGTGTCGCTGTGGCTTCTTCTACTTCTACTTCTAATGGTGCT
GCTGCTTCTACGTCAACTCAGCTTAATGGAACGTCTTTGGCGACGACGATGGGGGTGGGGCAAACAATGAATGTA
CGTGCGGAATTGCAGGCTCAACTTGCGCTTTTGGCTGTGCAGTTGGCGGAATTGGGACAGGAAGGTGAGAATGGT
GGTGGTGGTAATGGAGTGGTTGAGCAACTTTTGCAAAGTCAAAATGGGATGACTGTTGTTGGGTCAAGGAATGAA
GAAAATGGTATTGAAGGAGCGGTGACGCAAAGAGTGATTACCCCGCCTATGAATGGTTTAGTACCTCTTTCTCTT
GATTCGAATCCGAATCCGAATCCGAATACCATTTCGTCGGGGGTGGAGGGAACAAAATCTGTTTCGGCATCGGCA
TTGGAATCTCAAACGCGGTTAGGGAAGGAAAGAAAGGGGGATGATGATGATGATAGTTTGATTGATCCTCTCTAC
GAAATGCGAGTGTGGTGGTAG
Gene >Agabi119p4|611000
ATGCAGGCTGCCAGCTCGTCTTATCTTCCTCCTCATCCTCTATCACCCCCACCCCCACCACAACCTCCACAATCG
TATTACCAAGGATTATATCATATACAGTCTCTTGGTGTGTACAATACTCGTCGTCATTGATAAAATGAATAATCG
TAATTATTGTGGTGGAATAGGACCGCAGGATCATGAACTTAAGAGACAATATCTGGGTTTGTTGGAGACGAAACA
GGTTATTGAGATATGTTTGATGTTGGATGTGTATGTGGCGCCGTATGTGAGAGGTATGATTTGGCCTCAGGATTT
GGGGGCTGCGATTACTGGGTTGAGGAAATCGACGACGAGTAATGGTGCTTCTACTGCTGCTGGTGTTGGTGCTAG
TGCTGCGACTACGACGACGAGTAATGATGATGATGATGCTTCGGTGTCTACGACTAGGTCGGGGAGGAAGGAGGG
GGAGGAGGAACCTGTGATGGCTTCGTTGGATGGATTGAAGGAAGGATCTGGTGGTCGTGTTGTGGAAAATGGTGA
GAGGGTGGAGAAAGCATCGCAGGAGGTAACAAAAACAGCGGCGACGACGACGGAGATGGAGACGGCGCCGATGAG
TGGACTTGCTCAGGTATCGACATCATCAACGGGTGCATCTGCTACGCCTGCGCTTACATCTTCTACTCCTGCACC
TACGTCTTCTACTCCTGCTCCTGCGTCTGCTGCTCCTGCTCCTGCTCCCAATCAGCAACAGCCGCCTTATCCTCA
TCAGCCTTACGGTTATCCTCAACATCCTACGGCAGCCTATCCTCATGCACCATACTACCCACCACCTCCACCTGG
TTATCCTTCCTATCCTCCGTCATCGTACCCTCATTATCCACCACCCCCTAACGGTTATCCCACCGCACCAGGAGG
ATATCCCCTCCCTTACTCAACTCCATCATCACACCCTCATCAACAATCATTTCCACATCTTCATCCCCCTCCCCC
TCATCCGCAGTCCCATGTTCATCAAGAACAAACTCCAGATGAAATACCTAGTTATGAAGAAATGATTGTTGAAGC
GTTACAAGAATCTGCATCTGCAGATCCTGAAGGATGTGCACCTAAAGATCTGTTTTCGTGGATGGCGGCTAGGTA
TCCTTTGCAGTCGAATTTTAGGCCGTCGGCGAGTCAGGCTTTGCAGAAGGCTTTTAAGAGGGGGAGGTTGGAGAA
GAGTAGTAACGGAAAATATAGGTTGAGTGGGACTTGGGAAGGAGGAAGTGTAAGTGCCTCTGCCCAGATTGGTGA
GGTTTATCTTATTTTATTTTATTTGGTAGACGTCGAGAAGAACGACGAGACGTCCGCAAATGCAACAGCATAGTC
AACCTAATGCTATGGTACCACCATCGGCTTCGTCATCACATCCACAACTACCACCGTCTGGTTCACCGTTCACTC
ATGCTCCCCTTGTACACCATCACCATCATAATACGCATGCTTCAGCGTATCCTTATGCTTATGGATATCCTGGAT
ATCCTCAAATACATCCTGGACAACAACAACAACCATCTACAACAGATAATTCTGTTACGAAGAATACTACTGGAG
ATAAAACTACGATTGCTGCTGCGACGTCGGATGAATCGGATAAAGATGCATATGAAGCCGCTCAAAATATACTCA
AGGCCATCAATTTCGGTGATTTATTACAAATTTCTCAAACTGAAGAGGGGGGTAATAATGTTAATAATAAAGGAG
GAGGAGCGGCGGGAGGAGGAGATGCGGGGGAAGTGTCGATGGATCAACTTACGTCGTTGTTGATTCAAGCGCAAC
ATGCTATTTCGGGTCAGAGGCAGTCTATGGAGGGACAACAACAACAACAACAACAACAACAACAACAACAACAAC
AGGTTGCGGGAGCTTTGACTTCGAGTTTGCATGGTGGAGTGATAACGCCGTTACCGACGTTGAGCGCTACGGCTG
GTGTCGCTGTGGCTTCTTCTACTTCTACTTCTAATGGTGCTGCTGCTTCTACGTCAACTCAGCTTAATGGAACGT
CTTTGGCGACGACGATGGGGGTGGGGCAAACAATGAATGTACGTGCGGAATTGCAGGCTCAACTTGCGCTTTTGG
CTGTGCAGTTGGCGGAATTGGGACAGGAAGGTGAGAATGGTGGTGGTGGTAATGGAGTGGTTGAGCAACTTTTGC
AAAGTCAAAATGGGATGACTGTTGTTGGGTCAAGGAATGAAGAAAATGGTATTGAAGGAGCGGTGACGCAAAGAG
TGATTACCCCGCCTATGAATGGTTTAGTACCTCTTTCTCTTGATTCGAATCCGAATCCGAATCCGAATACCATTT
CGTCGGGGGTGGAGGGAACAAAATCTGTTTCGGCATCGGCATTGGAATCTCAAACGCGGTTAGGGAAGGAAAGAA
AGGGGGATGATGATGATGATAGTTTGATTGATCCTCTCTACGAAATGCGAGTGTGGTGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail