Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|609700
Gene name
Locationscaffold_03b:361650..363029
Strand+
Gene length (bp)1379
Transcript length (bp)1062
Coding sequence length (bp)1062
Protein length (aa) 354

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09184 PPP4R2 PPP4R2 4.2E-24 6 175

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9W2U4|PP4R2_DROME Serine/threonine-protein phosphatase 4 regulatory subunit 2 OS=Drosophila melanogaster GN=PPP4R2r PE=1 SV=2 78 146 2.0E-11
sp|Q5M7D6|P4R2A_XENLA Serine/threonine-protein phosphatase 4 regulatory subunit 2-A OS=Xenopus laevis GN=ppp4r2-a PE=2 SV=1 92 143 2.0E-08
sp|Q6DCQ0|P4R2B_XENLA Serine/threonine-protein phosphatase 4 regulatory subunit 2-B OS=Xenopus laevis GN=ppp4r2-b PE=2 SV=1 92 143 1.0E-07
sp|A1L1M4|P4R2B_DANRE Serine/threonine-protein phosphatase 4 regulatory subunit 2-B OS=Danio rerio GN=ppp4r2b PE=1 SV=2 91 143 1.0E-07
sp|Q6P964|P4R2A_DANRE Serine/threonine-protein phosphatase 4 regulatory subunit 2-A OS=Danio rerio GN=ppp4r2a PE=2 SV=2 82 143 1.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9W2U4|PP4R2_DROME Serine/threonine-protein phosphatase 4 regulatory subunit 2 OS=Drosophila melanogaster GN=PPP4R2r PE=1 SV=2 78 146 2.0E-11
sp|Q5M7D6|P4R2A_XENLA Serine/threonine-protein phosphatase 4 regulatory subunit 2-A OS=Xenopus laevis GN=ppp4r2-a PE=2 SV=1 92 143 2.0E-08
sp|Q6DCQ0|P4R2B_XENLA Serine/threonine-protein phosphatase 4 regulatory subunit 2-B OS=Xenopus laevis GN=ppp4r2-b PE=2 SV=1 92 143 1.0E-07
sp|A1L1M4|P4R2B_DANRE Serine/threonine-protein phosphatase 4 regulatory subunit 2-B OS=Danio rerio GN=ppp4r2b PE=1 SV=2 91 143 1.0E-07
sp|Q6P964|P4R2A_DANRE Serine/threonine-protein phosphatase 4 regulatory subunit 2-A OS=Danio rerio GN=ppp4r2a PE=2 SV=2 82 143 1.0E-07
sp|Q5ZMU6|PP4R2_CHICK Serine/threonine-protein phosphatase 4 regulatory subunit 2 OS=Gallus gallus GN=PPP4R2 PE=2 SV=1 7 143 2.0E-07
sp|Q0VGB7|PP4R2_MOUSE Serine/threonine-protein phosphatase 4 regulatory subunit 2 OS=Mus musculus GN=Ppp4r2 PE=1 SV=1 7 143 2.0E-07
sp|Q28IG6|PP4R2_XENTR Serine/threonine-protein phosphatase 4 regulatory subunit 2 OS=Xenopus tropicalis GN=ppp4r2 PE=2 SV=1 92 143 3.0E-07
sp|Q5R9U6|PP4R2_PONAB Serine/threonine-protein phosphatase 4 regulatory subunit 2 OS=Pongo abelii GN=PPP4R2 PE=2 SV=1 92 143 4.0E-07
sp|Q9NY27|PP4R2_HUMAN Serine/threonine-protein phosphatase 4 regulatory subunit 2 OS=Homo sapiens GN=PPP4R2 PE=1 SV=3 92 143 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0019888 protein phosphatase regulator activity Yes
GO:0030289 protein phosphatase 4 complex Yes
GO:0032991 protein-containing complex No
GO:0005963 magnesium-dependent protein serine/threonine phosphatase complex No
GO:0140535 intracellular protein-containing complex No
GO:0030234 enzyme regulator activity No
GO:0098772 molecular function regulator activity No
GO:0008287 protein serine/threonine phosphatase complex No
GO:1903293 phosphatase complex No
GO:0019208 phosphatase regulator activity No
GO:0003674 molecular_function No
GO:1902494 catalytic complex No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|609700
MAQHQAILENIASTDNVESDWSLIRDAVKQKIEENIQLYLTTTKPNPQPPPFSQTQTPNGGLKIAPFPTHKTVRV
HLNEKPVSYMTPEEAQQAKKYVFEQLDSFSSAPFSVQRLCELCVKPKSHYNSVGKYLRAVEKSILVTSEWDSFPP
LTEEEKDSFGRGATVLGSTRQSAPSTPLFSPIPFLHEDARRSQSRSPPPSPLALASAASTGDVSAQPLETKALGM
VDEMDDPGPGHLSDHPTALSAVTELSGEHFNSQPESTSTTSTSASQSNTSTSRPLFGSLEQRHSSAHVYSITVVV
ISGSRSLHHASRMRSPVESKGSWLLLLLTVHHSCLHHVKHTNLPRSVPSADRI*
Coding >Agabi119p4|609700
ATGGCACAGCACCAGGCCATCCTCGAAAACATCGCATCTACAGACAACGTAGAGTCTGACTGGTCACTCATACGC
GACGCCGTAAAACAAAAAATCGAAGAGAACATCCAGCTATATCTAACAACCACCAAACCAAATCCTCAACCACCG
CCTTTCAGCCAAACCCAAACTCCAAATGGAGGGCTCAAGATTGCGCCTTTCCCAACGCACAAAACAGTCCGTGTT
CATTTGAACGAGAAACCTGTCAGTTATATGACGCCGGAAGAGGCGCAACAAGCCAAGAAATATGTTTTTGAACAG
CTTGATAGTTTTAGTTCTGCACCATTCTCTGTACAACGGCTTTGCGAACTCTGCGTTAAACCCAAAAGTCATTAC
AATTCTGTCGGAAAATACCTTCGCGCCGTCGAAAAGTCAATACTCGTCACCTCGGAATGGGATAGTTTCCCTCCA
CTGACGGAGGAAGAAAAGGATTCCTTTGGACGTGGTGCTACAGTGTTAGGCTCTACTCGACAATCCGCTCCCTCA
ACCCCATTGTTTTCACCTATTCCATTCCTACACGAAGATGCTCGTAGATCACAATCGCGTAGTCCACCACCCTCG
CCTTTAGCATTAGCAAGTGCTGCATCTACCGGCGATGTCAGTGCTCAACCTTTGGAGACCAAAGCTCTGGGAATG
GTCGATGAAATGGATGATCCTGGACCTGGGCACTTGAGTGACCATCCCACTGCATTAAGTGCAGTCACGGAATTA
AGTGGAGAACACTTCAATTCCCAGCCAGAATCGACTTCAACGACATCCACCTCAGCATCTCAATCAAATACTTCC
ACCTCACGTCCACTATTTGGGAGTTTAGAACAGAGGCACAGTAGTGCTCACGTCTACTCGATTACTGTGGTAGTG
ATCTCGGGATCAAGAAGTCTACACCACGCAAGTCGCATGAGGAGTCCAGTTGAATCGAAAGGTTCTTGGCTGCTC
CTGCTGTTAACGGTCCATCATTCTTGTCTACACCACGTCAAGCACACCAATCTGCCAAGGTCTGTTCCGTCCGCG
GACAGAATTTAA
Transcript >Agabi119p4|609700
ATGGCACAGCACCAGGCCATCCTCGAAAACATCGCATCTACAGACAACGTAGAGTCTGACTGGTCACTCATACGC
GACGCCGTAAAACAAAAAATCGAAGAGAACATCCAGCTATATCTAACAACCACCAAACCAAATCCTCAACCACCG
CCTTTCAGCCAAACCCAAACTCCAAATGGAGGGCTCAAGATTGCGCCTTTCCCAACGCACAAAACAGTCCGTGTT
CATTTGAACGAGAAACCTGTCAGTTATATGACGCCGGAAGAGGCGCAACAAGCCAAGAAATATGTTTTTGAACAG
CTTGATAGTTTTAGTTCTGCACCATTCTCTGTACAACGGCTTTGCGAACTCTGCGTTAAACCCAAAAGTCATTAC
AATTCTGTCGGAAAATACCTTCGCGCCGTCGAAAAGTCAATACTCGTCACCTCGGAATGGGATAGTTTCCCTCCA
CTGACGGAGGAAGAAAAGGATTCCTTTGGACGTGGTGCTACAGTGTTAGGCTCTACTCGACAATCCGCTCCCTCA
ACCCCATTGTTTTCACCTATTCCATTCCTACACGAAGATGCTCGTAGATCACAATCGCGTAGTCCACCACCCTCG
CCTTTAGCATTAGCAAGTGCTGCATCTACCGGCGATGTCAGTGCTCAACCTTTGGAGACCAAAGCTCTGGGAATG
GTCGATGAAATGGATGATCCTGGACCTGGGCACTTGAGTGACCATCCCACTGCATTAAGTGCAGTCACGGAATTA
AGTGGAGAACACTTCAATTCCCAGCCAGAATCGACTTCAACGACATCCACCTCAGCATCTCAATCAAATACTTCC
ACCTCACGTCCACTATTTGGGAGTTTAGAACAGAGGCACAGTAGTGCTCACGTCTACTCGATTACTGTGGTAGTG
ATCTCGGGATCAAGAAGTCTACACCACGCAAGTCGCATGAGGAGTCCAGTTGAATCGAAAGGTTCTTGGCTGCTC
CTGCTGTTAACGGTCCATCATTCTTGTCTACACCACGTCAAGCACACCAATCTGCCAAGGTCTGTTCCGTCCGCG
GACAGAATTTAA
Gene >Agabi119p4|609700
ATGGCACAGCACCAGGCCATCCTCGAAAACATCGCATCTACAGACAACGTAGAGTCTGACTGGTCACTCATACGC
GACGCCGTAAAACAAAAAATCGAAGAGGTGCTCACTCCTTTTAGGCAAACCATTCCAGGCGATATTCAATTTGCA
TACAGAACATCCAGCTATATCTAACAACCACCAAACCAAATCCTCAACCACCGCCTTTCAGCCAAACCCAAACTC
CAAATGGAGGGCTCAAGATTGCGCCTTTCCCAACGCACAAAACAGTCCGTGTTCATTTGAACGAGAAACCTGTCA
GTTATATGACGCCGGAAGAGGCGCAACAAGCCAAGAAATATGTTTTTGAACAGCTTGATAGTTTTAGTTCGTGAG
TATATCTCTTAGTACCCCTTGTTTATTTTGACTCAAGAGGATCATAAAGTGCACCATTCTCTGTACAACGGCTTT
GCGAACTCTGCGTTAAACCCAAAAGTCATTACAATTCTGTCGGAAAATACCTTCGCGCCGTCGAAAAGTCAATAC
TCGTCACCTCGGAATGGGATAGTTTCCCTCCACTGACGGAGGAAGAAAAGGATTCCTTTGGACGTGGTGCTACAG
TGTTAGGCTCTACTCGACAATCCGCTCCCTCAACCCCATTGTTTTCACCTATTCCATTCCTACACGAAGATGCTC
GTAGATCACAATCGCGTAGTCCACCACCCTCGCCTTTAGCATTAGCAAGTGCTGCATCTACCGGCGATGTCAGTG
CTCAACCTTTGGAGACCAAAGCTCTGGGAATGGTCGATGAAATGGATGATCCTGGACCTGGGCACTTGAGTGACC
ATCCCACTGCATTAAGTGCAGTCACGGAATTAAGTGGAGAACACTTCAATTCCCAGCCAGAATCGACTTCAACGA
CATCCACCTCAGCATCTCAATCAAATACTTCCACCTCACGTCCACTATTTGGGAGTTTAGAACAGAGGTTTGTCA
GATCTGGACTAATGGGTCCAGCGTCAGACGGTATGATGGTAGAAGAAAATAAAGAAAACACGCAGGCACAGTAGT
GGTATGTTTAAATTCCATAACCAAATCTTCTTTACATATGTACTTGGATAAACTGTGCTCATATCTATCGTGTGA
TCCTAGCTCACGTCTACTCGATTACTGTGGTAGTGATCTCGGGATCAAGGCTGGTATATTTAAACTTCATATCAC
AGCCGAAAACCCTAAAACTGTCAAACAATAGAAGTCTACACCACGCAAGTCGCATGAGGAGTCCAGTTGAATCGA
AAGGTTCTTGGCTGCTCCTGCTGTTAACGGTCCATCATTCTTGTCTACACCACGTCAAGCACACCAATCTGCCAA
GGTCTGTTCCGTCCGCGGACAGAATTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail