Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|609100
Gene name
Locationscaffold_03b:150845..151915
Strand+
Gene length (bp)1070
Transcript length (bp)870
Coding sequence length (bp)870
Protein length (aa) 290

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01257 2Fe-2S_thioredx Thioredoxin-like [2Fe-2S] ferredoxin 2.2E-58 58 204

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40915|NDUV2_NEUCR NADH-ubiquinone oxidoreductase 24 kDa subunit, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuo-24 PE=2 SV=1 2 233 3.0E-86
sp|P04394|NDUV2_BOVIN NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial OS=Bos taurus GN=NDUFV2 PE=1 SV=3 31 232 5.0E-85
sp|Q9D6J6|NDUV2_MOUSE NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial OS=Mus musculus GN=Ndufv2 PE=1 SV=2 31 232 2.0E-84
sp|P19234|NDUV2_RAT NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial OS=Rattus norvegicus GN=Ndufv2 PE=1 SV=2 31 232 2.0E-84
sp|Q0MQI9|NDUV2_PANTR NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial OS=Pan troglodytes GN=NDUFV2 PE=2 SV=1 31 231 1.0E-83
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40915|NDUV2_NEUCR NADH-ubiquinone oxidoreductase 24 kDa subunit, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuo-24 PE=2 SV=1 2 233 3.0E-86
sp|P04394|NDUV2_BOVIN NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial OS=Bos taurus GN=NDUFV2 PE=1 SV=3 31 232 5.0E-85
sp|Q9D6J6|NDUV2_MOUSE NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial OS=Mus musculus GN=Ndufv2 PE=1 SV=2 31 232 2.0E-84
sp|P19234|NDUV2_RAT NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial OS=Rattus norvegicus GN=Ndufv2 PE=1 SV=2 31 232 2.0E-84
sp|Q0MQI9|NDUV2_PANTR NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial OS=Pan troglodytes GN=NDUFV2 PE=2 SV=1 31 231 1.0E-83
sp|P19404|NDUV2_HUMAN NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial OS=Homo sapiens GN=NDUFV2 PE=1 SV=2 31 232 1.0E-83
sp|Q0MQI7|NDUV2_PONPY NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial OS=Pongo pygmaeus GN=NDUFV2 PE=2 SV=1 31 232 1.0E-83
sp|Q0MQI8|NDUV2_GORGO NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial OS=Gorilla gorilla gorilla GN=NDUFV2 PE=2 SV=1 31 232 1.0E-83
sp|Q54F10|NDUV2_DICDI NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial OS=Dictyostelium discoideum GN=ndufv2 PE=3 SV=1 18 230 5.0E-78
sp|Q20719|NDUV2_CAEEL Probable NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial OS=Caenorhabditis elegans GN=F53F4.10 PE=3 SV=1 8 230 2.0E-76
sp|Q1RJJ1|NUOE_RICBR NADH-quinone oxidoreductase subunit E OS=Rickettsia bellii (strain RML369-C) GN=nuoE PE=3 SV=1 47 204 7.0E-64
sp|O22769|NDUV2_ARATH NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial OS=Arabidopsis thaliana GN=At4g02580 PE=2 SV=3 1 216 5.0E-63
sp|Q9ZDH5|NUOE_RICPR NADH-quinone oxidoreductase subunit E OS=Rickettsia prowazekii (strain Madrid E) GN=nuoE PE=3 SV=1 47 211 4.0E-61
sp|Q68X20|NUOE_RICTY NADH-quinone oxidoreductase subunit E OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=nuoE PE=3 SV=1 47 204 9.0E-61
sp|Q4UM09|NUOE_RICFE NADH-quinone oxidoreductase subunit E OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=nuoE PE=3 SV=1 47 209 1.0E-58
sp|Q92ID9|NUOE_RICCN NADH-quinone oxidoreductase subunit E OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=nuoE PE=3 SV=1 47 205 9.0E-57
sp|P29914|NQO2_PARDE NADH-quinone oxidoreductase chain 2 OS=Paracoccus denitrificans GN=nqo2 PE=1 SV=1 47 232 2.0E-47
sp|P56909|NUOE1_RHIME NADH-quinone oxidoreductase subunit E 1 OS=Rhizobium meliloti (strain 1021) GN=nuoE1 PE=3 SV=1 47 232 1.0E-42
sp|P56910|NUOE2_RHIME NADH-quinone oxidoreductase subunit E 2 OS=Rhizobium meliloti (strain 1021) GN=nuoE2 PE=3 SV=2 58 209 1.0E-30
sp|Q56221|NQO2_THET8 NADH-quinone oxidoreductase subunit 2 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=nqo2 PE=1 SV=3 62 209 1.0E-26
sp|Q9I0J8|NUOE_PSEAE NADH-quinone oxidoreductase subunit E OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=nuoE PE=3 SV=1 70 204 4.0E-24
sp|O66842|NUOE_AQUAE NADH-quinone oxidoreductase subunit E OS=Aquifex aeolicus (strain VF5) GN=nuoE PE=3 SV=1 44 205 6.0E-23
sp|P9WIV5|NUOE_MYCTU NADH-quinone oxidoreductase subunit E OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=nuoE PE=1 SV=1 57 211 3.0E-22
sp|P9WIV4|NUOE_MYCTO NADH-quinone oxidoreductase subunit E OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=nuoE PE=3 SV=1 57 211 3.0E-22
sp|P65574|NUOE_MYCBO NADH-quinone oxidoreductase subunit E OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=nuoE PE=3 SV=1 57 211 3.0E-22
sp|P0AFD2|NUOE_ECOL6 NADH-quinone oxidoreductase subunit E OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=nuoE PE=3 SV=1 70 204 8.0E-22
sp|P0AFD1|NUOE_ECOLI NADH-quinone oxidoreductase subunit E OS=Escherichia coli (strain K12) GN=nuoE PE=1 SV=1 70 204 8.0E-22
sp|P0AFD3|NUOE_SHIFL NADH-quinone oxidoreductase subunit E OS=Shigella flexneri GN=nuoE PE=3 SV=1 70 204 8.0E-22
sp|P0A1Y8|NUOE_SALTY NADH-quinone oxidoreductase subunit E OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=nuoE PE=3 SV=1 70 204 4.0E-21
sp|P0A1Y9|NUOE_SALTI NADH-quinone oxidoreductase subunit E OS=Salmonella typhi GN=nuoE PE=3 SV=1 70 204 4.0E-21
sp|P57255|NUOE_BUCAI NADH-quinone oxidoreductase subunit E OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=nuoE PE=3 SV=1 70 204 1.0E-20
sp|Q8K9Y4|NUOE_BUCAP NADH-quinone oxidoreductase subunit E OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=nuoE PE=3 SV=1 70 204 2.0E-20
sp|Q89AU3|NUOE_BUCBP NADH-quinone oxidoreductase subunit E OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=nuoE PE=3 SV=1 70 204 5.0E-20
sp|Q46505|HNDA_DESFR NADP-reducing hydrogenase subunit HndA OS=Desulfovibrio fructosivorans GN=hndA PE=1 SV=1 66 204 6.0E-19
sp|O13691|NDUV2_SCHPO NADH-ubiquinone oxidoreductase 24 kDa subunit homolog C11E3.12, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11E3.12 PE=3 SV=1 49 206 2.0E-12
sp|P22317|HOXF_CUPNH NAD-reducing hydrogenase HoxS subunit alpha OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=hoxF PE=1 SV=1 91 231 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|609100
MLSRLPRSLASSSKVAQRRFISTTTRRRSEALFAHRDTTYNNPKIPFEFNAENVKRAQAIIAKYPPQYKKAAVIP
LLDLAQRQNNGWTSISAMNHVATVLEMPPMRVYEVATFYTMFNREPIGKNFVQVCTTTPCVLRGSTEILDTVCTE
LGGIKPGQTTKDGKFTVIEVECQGACSNAPMMVVGDDFYEDLTPATTKKILDAFSRGEKPKPGPQSGRFTSENSA
GLTALTSKASTSSSHLEYTSFDARFLSALRSGRVLLTRISIVEIDRHPACNLTAFFLLEWERLF*
Coding >Agabi119p4|609100
ATGTTATCCAGGCTCCCGAGGTCTTTGGCTTCTTCCTCGAAAGTCGCACAGCGGAGATTCATTTCCACTACCACG
CGGAGGAGATCAGAGGCTCTCTTTGCGCACCGGGATACAACTTATAATAACCCCAAGATTCCGTTCGAGTTTAAT
GCAGAGAACGTGAAGCGTGCCCAAGCGATCATTGCCAAATACCCTCCTCAATATAAGAAGGCCGCCGTTATTCCT
CTTCTGGATCTCGCTCAACGACAAAACAATGGATGGACGAGCATCAGTGCGATGAACCATGTGGCGACAGTTCTT
GAGATGCCTCCTATGCGCGTGTACGAGGTCGCTACCTTCTATACGATGTTTAACCGGGAACCTATTGGCAAAAAC
TTTGTTCAAGTTTGCACGACGACGCCTTGTGTACTCCGAGGTTCAACTGAAATTCTCGACACAGTTTGCACAGAA
CTCGGAGGAATTAAGCCCGGTCAAACGACAAAGGACGGAAAGTTCACCGTAATCGAGGTTGAATGTCAAGGTGCT
TGTAGTAATGCACCAATGATGGTCGTTGGCGATGATTTCTACGAAGACCTGACACCAGCAACTACCAAGAAAATT
CTTGATGCATTCTCTCGAGGCGAGAAACCTAAGCCCGGACCCCAGAGCGGTCGCTTCACCAGTGAAAACTCGGCG
GGCCTGACAGCACTTACCTCAAAGGCGAGTACCTCCTCTTCTCATCTAGAGTACACTTCGTTTGACGCGAGATTC
CTATCAGCCTTACGGTCCGGGAGAGTTCTGCTCACCCGAATTTCAATAGTAGAAATTGATAGGCACCCTGCTTGC
AATCTCACTGCTTTTTTTTTATTGGAATGGGAAAGACTTTTTTGA
Transcript >Agabi119p4|609100
ATGTTATCCAGGCTCCCGAGGTCTTTGGCTTCTTCCTCGAAAGTCGCACAGCGGAGATTCATTTCCACTACCACG
CGGAGGAGATCAGAGGCTCTCTTTGCGCACCGGGATACAACTTATAATAACCCCAAGATTCCGTTCGAGTTTAAT
GCAGAGAACGTGAAGCGTGCCCAAGCGATCATTGCCAAATACCCTCCTCAATATAAGAAGGCCGCCGTTATTCCT
CTTCTGGATCTCGCTCAACGACAAAACAATGGATGGACGAGCATCAGTGCGATGAACCATGTGGCGACAGTTCTT
GAGATGCCTCCTATGCGCGTGTACGAGGTCGCTACCTTCTATACGATGTTTAACCGGGAACCTATTGGCAAAAAC
TTTGTTCAAGTTTGCACGACGACGCCTTGTGTACTCCGAGGTTCAACTGAAATTCTCGACACAGTTTGCACAGAA
CTCGGAGGAATTAAGCCCGGTCAAACGACAAAGGACGGAAAGTTCACCGTAATCGAGGTTGAATGTCAAGGTGCT
TGTAGTAATGCACCAATGATGGTCGTTGGCGATGATTTCTACGAAGACCTGACACCAGCAACTACCAAGAAAATT
CTTGATGCATTCTCTCGAGGCGAGAAACCTAAGCCCGGACCCCAGAGCGGTCGCTTCACCAGTGAAAACTCGGCG
GGCCTGACAGCACTTACCTCAAAGGCGAGTACCTCCTCTTCTCATCTAGAGTACACTTCGTTTGACGCGAGATTC
CTATCAGCCTTACGGTCCGGGAGAGTTCTGCTCACCCGAATTTCAATAGTAGAAATTGATAGGCACCCTGCTTGC
AATCTCACTGCTTTTTTTTTATTGGAATGGGAAAGACTTTTTTGA
Gene >Agabi119p4|609100
ATGTTATCCAGGCTCCCGAGGTCTTTGGCTTCTTCCTCGAAAGTCGCACAGCGGAGATTCATTTCCACTACCACG
CGGAGGAGATCAGAGGCTCTCTTTGCGGTATGTCTACGCCGTTCGGAGGATACGAATAGTTGCTGAGCTCCGTAC
AGCACCGGGATACAACTTATAATAACCCCAAGGTTAATCCTATACACGCAATCTATATTGAACGGTAGATGACTT
TGTCACAGATTCCGTTCGAGTTTAATGCAGAGAACGTGAAGCGTGCCCAAGCGATCATTGCCAAATACCCTCCTC
AATATAAGAAGGCCGCCGTTATTCCTCTTCTGGATCTCGCTCAACGACAAAACAATGGATGGACGAGCATCAGTG
CGATGAACCATGTGGCGACAGTTCTTGAGATGCCTCCTATGCGCGTGTACGAGGTCGCTACCTTCTATACGATGT
TTAACCGGTATATCTTGCCCCCTCTTCTTTGTTTCTGACTTGACTTGTCCATTCTAGGGAACCTATTGGCAAAAA
CTTTGTTCAAGTTTGCACGACGACGCCTTGTGTACTCCGAGGTTCAACTGAAATTCTCGACACAGTTTGCACAGA
ACTCGGAGGAATTAAGCCCGGTCAAACGACAAAGGACGGAAAGTTCACCGTAATCGAGGTTGAATGTCAAGGTGC
TTGTAGTAATGCACCAATGATGGTCGTTGGCGATGATTTCTACGTCAGTGGCCAGATTCGTCTAAATATTATATC
TACTGACGTCTCTATAGGAAGACCTGACACCAGCAACTACCAAGAAAATTCTTGATGCATTCTCTCGAGGCGAGA
AACCTAAGCCCGGACCCCAGAGCGGTCGCTTCACCAGTGAAAACTCGGCGGGCCTGACAGCACTTACCTCAAAGG
CGAGTACCTCCTCTTCTCATCTAGAGTACACTTCGTTTGACGCGAGATTCCTATCAGCCTTACGGTCCGGGAGAG
TTCTGCTCACCCGAATTTCAATAGTAGAAATTGATAGGCACCCTGCTTGCAATCTCACTGCTTTTTTTTTATTGG
AATGGGAAAGACTTTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail