Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|607750
Gene name
Locationscaffold_03b:7139..8048
Strand-
Gene length (bp)909
Transcript length (bp)909
Coding sequence length (bp)909
Protein length (aa) 303

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13650 Asp_protease_2 Aspartyl protease 1.5E-07 166 255
PF13975 gag-asp_proteas gag-polyprotein putative aspartyl protease 2.1E-07 167 253

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID5
Orthogroup80
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|291900
Agaricus bisporus var bisporus H39 AgabiH39|435100
Agaricus bisporus var bisporus H97 AgabiH97|039720
Agaricus bisporus var bisporus H97 AgabiH97|086810
Agaricus bisporus var bisporus H97 AgabiH97|089510
Agaricus bisporus var bisporus H97 AgabiH97|098710
Agaricus bisporus var bisporus H97 AgabiH97|107800
Agaricus bisporus var burnettii H119p4 Agabi119p4|572750
Agaricus bisporus var burnettii H119p4 Agabi119p4|607750 (this protein)
Agaricus bisporus var burnettii H119p4 Agabi119p4|638450
Agaricus bisporus var burnettii H119p4 Agabi119p4|715400
Agaricus bisporus var burnettii H119p4 Agabi119p4|733500
Agaricus bisporus var burnettii H119p4 Agabi119p4|748950
Agaricus bisporus var burnettii H119p4 Agabi119p4|766550

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|607750
MKPVVDVPPLPAKYFREEKKGPSYKQQARIEEGISIEEMLDKFGETEIKLSQKELLAMAPKLREALKDLLSKRRV
PTGENNAFEASIEEDTKNEWLYTNVEDLGKAKKVQTVARDKGGELVEVWEVEEPLTQYLTTLPPDKRDRLVFTVE
TAEIKSAGNMGQLRVIPAVINGVREEEALLDSGSQIVTMSREAASDCKIPWDPSLAINMQSANGSITRTCGLAKN
VPFIFGNITVYLQVHVIEEAPYRVLLGRPFDVITESKVVNSSSGQQFITITDPNTKEWASLATYDKGELPKTMET
NF*
Coding >Agabi119p4|607750
ATGAAGCCGGTAGTGGATGTACCTCCGCTACCAGCGAAATACTTTAGAGAAGAAAAGAAGGGCCCTAGTTATAAA
CAACAGGCCAGAATCGAAGAAGGCATTAGTATCGAAGAGATGCTAGATAAATTCGGCGAAACGGAGATAAAACTC
TCCCAGAAGGAACTACTAGCAATGGCACCTAAGCTACGCGAAGCCCTTAAAGACTTATTGAGCAAGCGAAGGGTC
CCTACAGGTGAAAATAATGCCTTCGAAGCGAGCATAGAGGAAGATACAAAAAATGAATGGTTATATACCAATGTC
GAGGATCTCGGAAAAGCTAAGAAAGTGCAAACTGTAGCTCGAGACAAGGGAGGGGAATTGGTAGAGGTCTGGGAA
GTAGAGGAACCTCTCACCCAGTATTTAACTACACTACCCCCGGATAAGAGGGACCGTTTAGTTTTCACGGTAGAG
ACGGCAGAAATAAAGAGTGCCGGAAATATGGGACAGCTTCGAGTAATCCCAGCAGTAATAAATGGGGTTCGCGAA
GAAGAAGCTTTGCTAGATAGTGGATCACAGATAGTGACCATGAGTCGAGAAGCAGCTAGTGACTGCAAGATACCT
TGGGACCCATCGTTAGCAATTAATATGCAAAGTGCTAATGGAAGTATAACCCGGACTTGCGGGTTAGCGAAGAAC
GTTCCTTTCATTTTCGGAAATATTACCGTGTATCTACAAGTACATGTTATCGAAGAAGCTCCCTACCGAGTATTA
TTAGGGAGGCCCTTTGACGTGATCACAGAAAGCAAAGTAGTGAACTCTTCTTCGGGACAACAGTTCATCACTATC
ACGGATCCAAACACGAAAGAATGGGCTTCGTTAGCTACTTATGATAAAGGGGAGCTACCCAAAACTATGGAGACA
AATTTTTAA
Transcript >Agabi119p4|607750
ATGAAGCCGGTAGTGGATGTACCTCCGCTACCAGCGAAATACTTTAGAGAAGAAAAGAAGGGCCCTAGTTATAAA
CAACAGGCCAGAATCGAAGAAGGCATTAGTATCGAAGAGATGCTAGATAAATTCGGCGAAACGGAGATAAAACTC
TCCCAGAAGGAACTACTAGCAATGGCACCTAAGCTACGCGAAGCCCTTAAAGACTTATTGAGCAAGCGAAGGGTC
CCTACAGGTGAAAATAATGCCTTCGAAGCGAGCATAGAGGAAGATACAAAAAATGAATGGTTATATACCAATGTC
GAGGATCTCGGAAAAGCTAAGAAAGTGCAAACTGTAGCTCGAGACAAGGGAGGGGAATTGGTAGAGGTCTGGGAA
GTAGAGGAACCTCTCACCCAGTATTTAACTACACTACCCCCGGATAAGAGGGACCGTTTAGTTTTCACGGTAGAG
ACGGCAGAAATAAAGAGTGCCGGAAATATGGGACAGCTTCGAGTAATCCCAGCAGTAATAAATGGGGTTCGCGAA
GAAGAAGCTTTGCTAGATAGTGGATCACAGATAGTGACCATGAGTCGAGAAGCAGCTAGTGACTGCAAGATACCT
TGGGACCCATCGTTAGCAATTAATATGCAAAGTGCTAATGGAAGTATAACCCGGACTTGCGGGTTAGCGAAGAAC
GTTCCTTTCATTTTCGGAAATATTACCGTGTATCTACAAGTACATGTTATCGAAGAAGCTCCCTACCGAGTATTA
TTAGGGAGGCCCTTTGACGTGATCACAGAAAGCAAAGTAGTGAACTCTTCTTCGGGACAACAGTTCATCACTATC
ACGGATCCAAACACGAAAGAATGGGCTTCGTTAGCTACTTATGATAAAGGGGAGCTACCCAAAACTATGGAGACA
AATTTTTAA
Gene >Agabi119p4|607750
ATGAAGCCGGTAGTGGATGTACCTCCGCTACCAGCGAAATACTTTAGAGAAGAAAAGAAGGGCCCTAGTTATAAA
CAACAGGCCAGAATCGAAGAAGGCATTAGTATCGAAGAGATGCTAGATAAATTCGGCGAAACGGAGATAAAACTC
TCCCAGAAGGAACTACTAGCAATGGCACCTAAGCTACGCGAAGCCCTTAAAGACTTATTGAGCAAGCGAAGGGTC
CCTACAGGTGAAAATAATGCCTTCGAAGCGAGCATAGAGGAAGATACAAAAAATGAATGGTTATATACCAATGTC
GAGGATCTCGGAAAAGCTAAGAAAGTGCAAACTGTAGCTCGAGACAAGGGAGGGGAATTGGTAGAGGTCTGGGAA
GTAGAGGAACCTCTCACCCAGTATTTAACTACACTACCCCCGGATAAGAGGGACCGTTTAGTTTTCACGGTAGAG
ACGGCAGAAATAAAGAGTGCCGGAAATATGGGACAGCTTCGAGTAATCCCAGCAGTAATAAATGGGGTTCGCGAA
GAAGAAGCTTTGCTAGATAGTGGATCACAGATAGTGACCATGAGTCGAGAAGCAGCTAGTGACTGCAAGATACCT
TGGGACCCATCGTTAGCAATTAATATGCAAAGTGCTAATGGAAGTATAACCCGGACTTGCGGGTTAGCGAAGAAC
GTTCCTTTCATTTTCGGAAATATTACCGTGTATCTACAAGTACATGTTATCGAAGAAGCTCCCTACCGAGTATTA
TTAGGGAGGCCCTTTGACGTGATCACAGAAAGCAAAGTAGTGAACTCTTCTTCGGGACAACAGTTCATCACTATC
ACGGATCCAAACACGAAAGAATGGGCTTCGTTAGCTACTTATGATAAAGGGGAGCTACCCAAAACTATGGAGACA
AATTTTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail