© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Agabi119p4|604000 |
| Gene name | |
| Location | scaffold_03a:1585412..1586651 |
| Strand | - |
| Gene length (bp) | 1239 |
| Transcript length (bp) | 870 |
| Coding sequence length (bp) | 870 |
| Protein length (aa) | 290 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00400 | WD40 | WD domain, G-beta repeat | 1.0E-06 | 69 | 113 |
| PF00400 | WD40 | WD domain, G-beta repeat | 8.2E-03 | 122 | 155 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|O94394|YQF1_SCHPO | Uncharacterized WD repeat-containing protein C126.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC126.01c PE=3 SV=2 | 1 | 268 | 5.0E-21 |
| sp|Q5JTN6|WDR38_HUMAN | WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1 | 55 | 255 | 7.0E-15 |
| sp|Q54KL5|WDR5_DICDI | WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 | 53 | 206 | 5.0E-14 |
| sp|Q9M2Z2|WDR5A_ARATH | COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 | 58 | 206 | 3.0E-13 |
| sp|Q8JZX3|POC1A_MOUSE | POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 | 74 | 253 | 8.0E-13 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|O94394|YQF1_SCHPO | Uncharacterized WD repeat-containing protein C126.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC126.01c PE=3 SV=2 | 1 | 268 | 5.0E-21 |
| sp|Q5JTN6|WDR38_HUMAN | WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1 | 55 | 255 | 7.0E-15 |
| sp|Q54KL5|WDR5_DICDI | WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 | 53 | 206 | 5.0E-14 |
| sp|Q9M2Z2|WDR5A_ARATH | COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 | 58 | 206 | 3.0E-13 |
| sp|Q8JZX3|POC1A_MOUSE | POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 | 74 | 253 | 8.0E-13 |
| sp|Q8NBT0|POC1A_HUMAN | POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 | 74 | 253 | 1.0E-12 |
| sp|Q61FW2|SEL10_CAEBR | F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis briggsae GN=sel-10 PE=3 SV=1 | 59 | 253 | 2.0E-12 |
| sp|Q9D7H2|WDR5B_MOUSE | WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 | 6 | 206 | 2.0E-12 |
| sp|Q2TBP4|POC1A_BOVIN | POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 | 74 | 253 | 3.0E-12 |
| sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 60 | 208 | 3.0E-12 |
| sp|P49695|PKWA_THECU | Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 | 60 | 210 | 4.0E-12 |
| sp|D3ZW91|POC1B_RAT | POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 | 48 | 253 | 5.0E-12 |
| sp|Q54R82|MKKA_DICDI | Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum GN=mkkA PE=1 SV=2 | 60 | 256 | 5.0E-12 |
| sp|Q1LV15|DAW1_DANRE | Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 | 60 | 253 | 5.0E-12 |
| sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 57 | 208 | 6.0E-12 |
| sp|Q4V8C4|WDR5B_RAT | WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 | 53 | 206 | 8.0E-12 |
| sp|Q4V8C4|WDR5B_RAT | WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 | 38 | 209 | 1.0E-11 |
| sp|Q8BHD1|POC1B_MOUSE | POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1 | 48 | 253 | 1.0E-11 |
| sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 46 | 208 | 2.0E-11 |
| sp|P90648|MHCKB_DICDI | Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1 | 16 | 253 | 2.0E-11 |
| sp|Q498M4|WDR5_RAT | WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 | 53 | 206 | 3.0E-11 |
| sp|P61965|WDR5_MOUSE | WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 | 53 | 206 | 3.0E-11 |
| sp|P61964|WDR5_HUMAN | WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 | 53 | 206 | 3.0E-11 |
| sp|Q2KIG2|WDR5_BOVIN | WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 | 53 | 206 | 3.0E-11 |
| sp|Q9D7H2|WDR5B_MOUSE | WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 | 38 | 209 | 4.0E-11 |
| sp|Q9Y297|FBW1A_HUMAN | F-box/WD repeat-containing protein 1A OS=Homo sapiens GN=BTRC PE=1 SV=1 | 73 | 263 | 4.0E-11 |
| sp|Q5M786|WDR5_XENTR | WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 | 53 | 206 | 4.0E-11 |
| sp|Q8YTC2|Y2800_NOSS1 | Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 | 60 | 253 | 4.0E-11 |
| sp|Q3ULA2|FBW1A_MOUSE | F-box/WD repeat-containing protein 1A OS=Mus musculus GN=Btrc PE=1 SV=2 | 73 | 263 | 4.0E-11 |
| sp|Q93794|SEL10_CAEEL | F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans GN=sel-10 PE=1 SV=3 | 45 | 253 | 6.0E-11 |
| sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 49 | 208 | 7.0E-11 |
| sp|Q86VZ2|WDR5B_HUMAN | WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 | 53 | 206 | 7.0E-11 |
| sp|Q91854|TRCB_XENLA | Beta-TrCP OS=Xenopus laevis GN=fbxw1 PE=2 SV=1 | 73 | 263 | 7.0E-11 |
| sp|Q7ZVF0|POC1A_DANRE | POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1 | 74 | 253 | 8.0E-11 |
| sp|Q5RE95|WDR5B_PONAB | WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 | 53 | 206 | 9.0E-11 |
| sp|Q28I85|POC1A_XENTR | POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 | 74 | 253 | 1.0E-10 |
| sp|P46800|GBLP_DICDI | Guanine nucleotide-binding protein subunit beta-like protein OS=Dictyostelium discoideum GN=gpbB PE=1 SV=2 | 44 | 249 | 1.0E-10 |
| sp|Q9V3J8|WDS_DROME | Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 | 53 | 206 | 1.0E-10 |
| sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 10 | 253 | 2.0E-10 |
| sp|Q8I0F4|LIS1_DICDI | Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1 | 60 | 207 | 2.0E-10 |
| sp|F6ZT52|POC1B_XENTR | POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1 | 74 | 253 | 2.0E-10 |
| sp|Q7T0P4|POC1A_XENLA | POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2 | 74 | 253 | 2.0E-10 |
| sp|D4AM37|SCONB_ARTBC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=sconB PE=3 SV=1 | 59 | 210 | 2.0E-10 |
| sp|D4D8P3|SCONB_TRIVH | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Trichophyton verrucosum (strain HKI 0517) GN=sconB PE=3 SV=1 | 59 | 164 | 3.0E-10 |
| sp|Q8YV57|Y2124_NOSS1 | Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 | 55 | 157 | 4.0E-10 |
| sp|A2CEH0|POC1B_DANRE | POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1 | 74 | 253 | 5.0E-10 |
| sp|P53622|COPA_YEAST | Coatomer subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COP1 PE=1 SV=2 | 60 | 201 | 5.0E-10 |
| sp|P38129|TAF5_YEAST | Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF5 PE=1 SV=1 | 60 | 272 | 5.0E-10 |
| sp|Q9C4Z6|GPLPB_ARATH | Receptor for activated C kinase 1B OS=Arabidopsis thaliana GN=RACK1B PE=1 SV=1 | 65 | 209 | 5.0E-10 |
| sp|Q8YV57|Y2124_NOSS1 | Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 | 60 | 154 | 6.0E-10 |
| sp|Q8VBV4|FBXW7_MOUSE | F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1 | 61 | 207 | 6.0E-10 |
| sp|O22785|PR19B_ARATH | Pre-mRNA-processing factor 19 homolog 2 OS=Arabidopsis thaliana GN=PRP19B PE=1 SV=3 | 44 | 253 | 6.0E-10 |
| sp|Q4V7Z1|POC1B_XENLA | POC1 centriolar protein homolog B OS=Xenopus laevis GN=poc1b PE=1 SV=1 | 74 | 253 | 6.0E-10 |
| sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 47 | 207 | 9.0E-10 |
| sp|Q9BVA0|KTNB1_HUMAN | Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 | 42 | 158 | 9.0E-10 |
| sp|Q969H0|FBXW7_HUMAN | F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1 | 61 | 207 | 9.0E-10 |
| sp|D4AM37|SCONB_ARTBC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=sconB PE=3 SV=1 | 74 | 253 | 1.0E-09 |
| sp|D4D8P3|SCONB_TRIVH | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Trichophyton verrucosum (strain HKI 0517) GN=sconB PE=3 SV=1 | 74 | 253 | 1.0E-09 |
| sp|O74319|TAF73_SCHPO | Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf73 PE=1 SV=1 | 67 | 207 | 1.0E-09 |
| sp|Q8BG40|KTNB1_MOUSE | Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 | 42 | 158 | 1.0E-09 |
| sp|O43017|SWD3_SCHPO | Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd3 PE=1 SV=1 | 98 | 207 | 1.0E-09 |
| sp|F1MNN4|FBXW7_BOVIN | F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2 | 61 | 207 | 1.0E-09 |
| sp|Q5RD06|POC1B_PONAB | POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 | 75 | 253 | 1.0E-09 |
| sp|Q8TC44|POC1B_HUMAN | POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 | 75 | 253 | 1.0E-09 |
| sp|Q6NVM2|KTNB1_XENTR | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 | 75 | 206 | 2.0E-09 |
| sp|C5FP68|SCONB_ARTOC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=sconB PE=3 SV=1 | 59 | 160 | 2.0E-09 |
| sp|C5FP68|SCONB_ARTOC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=sconB PE=3 SV=1 | 74 | 253 | 2.0E-09 |
| sp|Q4RJN5|LIS1_TETNG | Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 | 55 | 224 | 2.0E-09 |
| sp|Q4V7Y7|KTNB1_XENLA | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 | 75 | 158 | 2.0E-09 |
| sp|C3XVT5|LIS1_BRAFL | Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 | 55 | 224 | 2.0E-09 |
| sp|Q5ZIU8|KTNB1_CHICK | Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 | 75 | 184 | 2.0E-09 |
| sp|A8NEG8|LIS1_COPC7 | Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 | 55 | 206 | 2.0E-09 |
| sp|Q9LV28|GPLPC_ARATH | Receptor for activated C kinase 1C OS=Arabidopsis thaliana GN=RACK1C PE=1 SV=1 | 65 | 208 | 2.0E-09 |
| sp|P87053|POF1_SCHPO | F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof1 PE=1 SV=1 | 59 | 207 | 3.0E-09 |
| sp|Q86TI4|WDR86_HUMAN | WD repeat-containing protein 86 OS=Homo sapiens GN=WDR86 PE=2 SV=3 | 49 | 216 | 3.0E-09 |
| sp|Q86TI4|WDR86_HUMAN | WD repeat-containing protein 86 OS=Homo sapiens GN=WDR86 PE=2 SV=3 | 52 | 253 | 3.0E-09 |
| sp|Q8K450|SPG16_MOUSE | Sperm-associated antigen 16 protein OS=Mus musculus GN=Spag16 PE=1 SV=1 | 59 | 209 | 3.0E-09 |
| sp|Q8HXX0|LIS1_MACFA | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3 | 55 | 224 | 3.0E-09 |
| sp|B5X3Z6|LIS1A_SALSA | Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 | 55 | 224 | 3.0E-09 |
| sp|P56094|TUP1_KLULA | General transcriptional corepressor TUP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TUP1 PE=1 SV=2 | 96 | 157 | 3.0E-09 |
| sp|Q9USN3|UTP13_SCHPO | Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 | 61 | 215 | 3.0E-09 |
| sp|O61585|KTNB1_STRPU | Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 | 41 | 156 | 4.0E-09 |
| sp|Q7ZUV2|KTNB1_DANRE | Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 | 75 | 158 | 4.0E-09 |
| sp|P90648|MHCKB_DICDI | Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1 | 39 | 253 | 5.0E-09 |
| sp|Q5RE95|WDR5B_PONAB | WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 | 51 | 207 | 5.0E-09 |
| sp|C3XVT5|LIS1_BRAFL | Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 | 48 | 208 | 5.0E-09 |
| sp|Q7T394|LIS1A_DANRE | Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 | 55 | 224 | 5.0E-09 |
| sp|Q6NZH4|LIS1_XENTR | Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 | 55 | 224 | 5.0E-09 |
| sp|O76734|TUP1_DICDI | General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 | 61 | 155 | 5.0E-09 |
| sp|P43034|LIS1_HUMAN | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2 | 55 | 224 | 5.0E-09 |
| sp|D3ZW91|POC1B_RAT | POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 | 73 | 253 | 6.0E-09 |
| sp|Q5IS43|LIS1_PANTR | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3 | 55 | 224 | 6.0E-09 |
| sp|P63004|LIS1_RAT | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2 | 55 | 224 | 6.0E-09 |
| sp|P63005|LIS1_MOUSE | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2 | 55 | 224 | 6.0E-09 |
| sp|B0LSW3|LIS1_FELCA | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1 | 55 | 224 | 6.0E-09 |
| sp|P43033|LIS1_BOVIN | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 | 55 | 224 | 6.0E-09 |
| sp|O24076|GBLP_MEDSA | Guanine nucleotide-binding protein subunit beta-like protein OS=Medicago sativa GN=GB1 PE=2 SV=1 | 65 | 208 | 6.0E-09 |
| sp|P49695|PKWA_THECU | Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 | 41 | 208 | 7.0E-09 |
| sp|Q9V3J8|WDS_DROME | Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 | 60 | 209 | 7.0E-09 |
| sp|A8NEG8|LIS1_COPC7 | Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 | 60 | 157 | 7.0E-09 |
| sp|B3S4I5|LIS1_TRIAD | Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 | 44 | 253 | 7.0E-09 |
| sp|A8X8C6|TG125_CAEBR | WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 | 95 | 209 | 8.0E-09 |
| sp|Q17963|WDR51_CAEEL | WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 | 96 | 209 | 8.0E-09 |
| sp|Q6P2Y2|DAW1_XENTR | Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 | 60 | 207 | 8.0E-09 |
| sp|Q9PTR5|LIS1_CHICK | Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3 | 55 | 224 | 9.0E-09 |
| sp|Q5FWQ6|DAW1_XENLA | Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 | 60 | 207 | 9.0E-09 |
| sp|A7S338|LIS1_NEMVE | Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 | 59 | 216 | 9.0E-09 |
| sp|Q8BHD1|POC1B_MOUSE | POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1 | 75 | 253 | 1.0E-08 |
| sp|Q86VZ2|WDR5B_HUMAN | WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 | 51 | 207 | 1.0E-08 |
| sp|Q90ZL4|LIS1_XENLA | Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 | 55 | 224 | 1.0E-08 |
| sp|Q8MY12|MHCKC_DICDI | Myosin heavy chain kinase C OS=Dictyostelium discoideum GN=mhkC PE=1 SV=1 | 8 | 156 | 1.0E-08 |
| sp|D3BUN1|LIS1_POLPA | Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1 | 60 | 207 | 1.0E-08 |
| sp|Q9GL51|LIS1_PIG | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 | 55 | 224 | 1.0E-08 |
| sp|Q39836|GBLP_SOYBN | Guanine nucleotide-binding protein subunit beta-like protein OS=Glycine max PE=2 SV=1 | 65 | 208 | 1.0E-08 |
| sp|Q6P5M2|WDR61_DANRE | WD repeat-containing protein 61 OS=Danio rerio GN=wdr61 PE=2 SV=1 | 61 | 201 | 1.0E-08 |
| sp|P39014|MET30_YEAST | F-box protein MET30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET30 PE=1 SV=1 | 59 | 182 | 1.0E-08 |
| sp|Q91WQ5|TAF5L_MOUSE | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 | 60 | 156 | 1.0E-08 |
| sp|Q8YTC2|Y2800_NOSS1 | Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 | 54 | 156 | 2.0E-08 |
| sp|Q8YTC2|Y2800_NOSS1 | Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 | 60 | 156 | 2.0E-08 |
| sp|P53622|COPA_YEAST | Coatomer subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COP1 PE=1 SV=2 | 54 | 215 | 2.0E-08 |
| sp|P38129|TAF5_YEAST | Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF5 PE=1 SV=1 | 48 | 171 | 2.0E-08 |
| sp|P39014|MET30_YEAST | F-box protein MET30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET30 PE=1 SV=1 | 72 | 287 | 2.0E-08 |
| sp|B6GZA1|SCONB_PENRW | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=sconB PE=3 SV=1 | 59 | 205 | 2.0E-08 |
| sp|Q8H0T9|KTNB1_ARATH | Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 | 65 | 156 | 2.0E-08 |
| sp|Q9SZQ5|VIP3_ARATH | WD repeat-containing protein VIP3 OS=Arabidopsis thaliana GN=VIP3 PE=1 SV=1 | 59 | 181 | 2.0E-08 |
| sp|Q9WUC8|PLRG1_RAT | Pleiotropic regulator 1 OS=Rattus norvegicus GN=Plrg1 PE=2 SV=1 | 45 | 207 | 2.0E-08 |
| sp|Q4X0A9|SCONB_ASPFU | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sconB PE=3 SV=1 | 71 | 283 | 2.0E-08 |
| sp|B0XTS1|SCONB_ASPFC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=sconB PE=3 SV=1 | 71 | 283 | 2.0E-08 |
| sp|P93340|GBLP_NICPL | Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana plumbaginifolia PE=2 SV=1 | 65 | 213 | 2.0E-08 |
| sp|Q2KID6|PLRG1_BOVIN | Pleiotropic regulator 1 OS=Bos taurus GN=PLRG1 PE=2 SV=1 | 45 | 207 | 2.0E-08 |
| sp|O43660|PLRG1_HUMAN | Pleiotropic regulator 1 OS=Homo sapiens GN=PLRG1 PE=1 SV=1 | 45 | 207 | 2.0E-08 |
| sp|P16649|TUP1_YEAST | General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUP1 PE=1 SV=2 | 96 | 156 | 2.0E-08 |
| sp|Q00659|SCONB_EMENI | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sconB PE=3 SV=2 | 71 | 283 | 2.0E-08 |
| sp|Q00659|SCONB_EMENI | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sconB PE=3 SV=2 | 60 | 207 | 2.0E-08 |
| sp|Q3Y8L7|DAW1_CHLRE | Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 | 60 | 166 | 2.0E-08 |
| sp|Q0P593|DAW1_BOVIN | Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 | 60 | 206 | 2.0E-08 |
| sp|Q5REG7|LIS1_PONAB | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 | 55 | 224 | 2.0E-08 |
| sp|Q54ZP5|WDR48_DICDI | WD repeat-containing protein 48 homolog OS=Dictyostelium discoideum GN=DDB_G0277533 PE=3 SV=1 | 75 | 157 | 2.0E-08 |
| sp|Q498M4|WDR5_RAT | WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 | 51 | 209 | 3.0E-08 |
| sp|P61965|WDR5_MOUSE | WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 | 51 | 209 | 3.0E-08 |
| sp|P61964|WDR5_HUMAN | WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 | 51 | 209 | 3.0E-08 |
| sp|Q2KIG2|WDR5_BOVIN | WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 | 51 | 209 | 3.0E-08 |
| sp|F1MNN4|FBXW7_BOVIN | F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2 | 59 | 253 | 3.0E-08 |
| sp|O74855|NLE1_SCHPO | Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 | 77 | 253 | 3.0E-08 |
| sp|Q09990|LIN23_CAEEL | F-box/WD repeat-containing protein lin-23 OS=Caenorhabditis elegans GN=lin-23 PE=1 SV=2 | 57 | 268 | 3.0E-08 |
| sp|A1DHW6|SCONB_NEOFI | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sconB PE=3 SV=1 | 71 | 283 | 3.0E-08 |
| sp|Q922V4|PLRG1_MOUSE | Pleiotropic regulator 1 OS=Mus musculus GN=Plrg1 PE=1 SV=1 | 45 | 207 | 3.0E-08 |
| sp|Q8N0X2|SPG16_HUMAN | Sperm-associated antigen 16 protein OS=Homo sapiens GN=SPAG16 PE=2 SV=2 | 60 | 209 | 3.0E-08 |
| sp|O75529|TAF5L_HUMAN | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 | 60 | 156 | 3.0E-08 |
| sp|O14170|POP2_SCHPO | WD repeat-containing protein pop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop2 PE=1 SV=1 | 44 | 173 | 3.0E-08 |
| sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 61 | 208 | 4.0E-08 |
| sp|Q5M786|WDR5_XENTR | WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 | 51 | 209 | 4.0E-08 |
| sp|Q6NVM2|KTNB1_XENTR | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 | 34 | 209 | 4.0E-08 |
| sp|A1CF18|LIS12_ASPCL | Nuclear distribution protein nudF 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-2 PE=3 SV=1 | 59 | 228 | 4.0E-08 |
| sp|Q6BU94|PRP46_DEBHA | Pre-mRNA-splicing factor PRP46 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PRP46 PE=3 SV=2 | 97 | 253 | 4.0E-08 |
| sp|A1C7E4|SCONB_ASPCL | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sconB PE=3 SV=1 | 59 | 207 | 4.0E-08 |
| sp|Q803D2|LIS1B_DANRE | Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 | 55 | 224 | 4.0E-08 |
| sp|P83774|GBLP_CANAL | Guanine nucleotide-binding protein subunit beta-like protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ASC1 PE=1 SV=2 | 43 | 210 | 4.0E-08 |
| sp|Q5JTN6|WDR38_HUMAN | WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1 | 59 | 253 | 5.0E-08 |
| sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 60 | 253 | 5.0E-08 |
| sp|Q4X0A9|SCONB_ASPFU | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sconB PE=3 SV=1 | 59 | 160 | 5.0E-08 |
| sp|B0XTS1|SCONB_ASPFC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=sconB PE=3 SV=1 | 59 | 160 | 5.0E-08 |
| sp|Q6FLI3|CAF4_CANGA | CCR4-associated factor 4 homolog OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CAF4 PE=3 SV=1 | 32 | 253 | 5.0E-08 |
| sp|B5X3C4|LIS1B_SALSA | Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 | 59 | 224 | 5.0E-08 |
| sp|Q00664|LIS1_EMENI | Nuclear distribution protein nudF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nudF PE=1 SV=1 | 92 | 182 | 5.0E-08 |
| sp|Q9Y297|FBW1A_HUMAN | F-box/WD repeat-containing protein 1A OS=Homo sapiens GN=BTRC PE=1 SV=1 | 60 | 253 | 6.0E-08 |
| sp|Q3ULA2|FBW1A_MOUSE | F-box/WD repeat-containing protein 1A OS=Mus musculus GN=Btrc PE=1 SV=2 | 60 | 253 | 6.0E-08 |
| sp|Q8TC44|POC1B_HUMAN | POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 | 73 | 253 | 6.0E-08 |
| sp|Q6NVM2|KTNB1_XENTR | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 | 77 | 252 | 6.0E-08 |
| sp|Q4V7Y7|KTNB1_XENLA | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 | 65 | 209 | 6.0E-08 |
| sp|Q9SY00|WDR5B_ARATH | COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 | 48 | 154 | 6.0E-08 |
| sp|A2QP30|LIS1_ASPNC | Nuclear distribution protein nudF OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=nudF PE=3 SV=1 | 78 | 182 | 6.0E-08 |
| sp|Q54SF9|MHCKD_DICDI | Myosin heavy chain kinase D OS=Dictyostelium discoideum GN=mhkD PE=3 SV=1 | 78 | 263 | 6.0E-08 |
| sp|Q9D994|WDR38_MOUSE | WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1 | 55 | 255 | 6.0E-08 |
| sp|A1DHW6|SCONB_NEOFI | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sconB PE=3 SV=1 | 59 | 160 | 7.0E-08 |
| sp|Q0D0X6|LIS1_ASPTN | Nuclear distribution protein nudF OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=nudF PE=3 SV=1 | 98 | 182 | 7.0E-08 |
| sp|Q4V7Y7|KTNB1_XENLA | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 | 77 | 252 | 8.0E-08 |
| sp|Q42384|PRL1_ARATH | Protein pleiotropic regulatory locus 1 OS=Arabidopsis thaliana GN=PRL1 PE=1 SV=1 | 61 | 181 | 8.0E-08 |
| sp|Q8YTC2|Y2800_NOSS1 | Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 | 55 | 253 | 9.0E-08 |
| sp|Q93794|SEL10_CAEEL | F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans GN=sel-10 PE=1 SV=3 | 60 | 206 | 9.0E-08 |
| sp|Q5RD06|POC1B_PONAB | POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 | 73 | 253 | 9.0E-08 |
| sp|Q5ZIU8|KTNB1_CHICK | Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 | 38 | 209 | 1.0E-07 |
| sp|Q7ZUV2|KTNB1_DANRE | Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 | 65 | 209 | 1.0E-07 |
| sp|Q8SQS4|TAF5_ENCCU | Transcription initiation factor TFIID subunit 5 OS=Encephalitozoon cuniculi (strain GB-M1) GN=TAF5 PE=1 SV=1 | 53 | 182 | 1.0E-07 |
| sp|Q9VZF4|FBXW7_DROME | F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster GN=ago PE=1 SV=1 | 68 | 253 | 1.0E-07 |
| sp|Q9VZF4|FBXW7_DROME | F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster GN=ago PE=1 SV=1 | 67 | 207 | 1.0E-07 |
| sp|B6Q4Z5|SCONB_TALMQ | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=sconB PE=3 SV=1 | 60 | 160 | 1.0E-07 |
| sp|O13282|TAF5_SCHPO | Transcription initiation factor TFIID subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf5 PE=1 SV=1 | 59 | 207 | 1.0E-07 |
| sp|P25387|GBLP_CHLRE | Guanine nucleotide-binding protein subunit beta-like protein OS=Chlamydomonas reinhardtii GN=GBLP PE=2 SV=1 | 69 | 230 | 1.0E-07 |
| sp|D3TLL6|LIS1_GLOMM | Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1 | 60 | 156 | 1.0E-07 |
| sp|Q5SRY7|FBW1B_MOUSE | F-box/WD repeat-containing protein 11 OS=Mus musculus GN=Fbxw11 PE=1 SV=1 | 60 | 253 | 1.0E-07 |
| sp|Q8VEJ4|NLE1_MOUSE | Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 | 60 | 154 | 1.0E-07 |
| sp|C4JPW9|LIS12_UNCRE | Nuclear distribution protein PAC1-2 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-2 PE=3 SV=1 | 82 | 182 | 1.0E-07 |
| sp|Q01277|SCONB_NEUCR | Probable E3 ubiquitin ligase complex SCF subunit scon-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=scon-2 PE=1 SV=1 | 60 | 206 | 1.0E-07 |
| sp|Q54KL5|WDR5_DICDI | WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 | 55 | 157 | 2.0E-07 |
| sp|P49695|PKWA_THECU | Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 | 106 | 227 | 2.0E-07 |
| sp|Q8YTC2|Y2800_NOSS1 | Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 | 50 | 157 | 2.0E-07 |
| sp|Q8YTC2|Y2800_NOSS1 | Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 | 60 | 167 | 2.0E-07 |
| sp|Q8YV57|Y2124_NOSS1 | Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 | 69 | 253 | 2.0E-07 |
| sp|Q9BVA0|KTNB1_HUMAN | Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 | 58 | 209 | 2.0E-07 |
| sp|Q8BG40|KTNB1_MOUSE | Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 | 58 | 209 | 2.0E-07 |
| sp|O61585|KTNB1_STRPU | Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 | 77 | 253 | 2.0E-07 |
| sp|Q9NDC9|LIS1_CAEEL | Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1 | 67 | 208 | 2.0E-07 |
| sp|Q9UKB1|FBW1B_HUMAN | F-box/WD repeat-containing protein 11 OS=Homo sapiens GN=FBXW11 PE=1 SV=1 | 60 | 253 | 2.0E-07 |
| sp|Q17N69|LIS1_AEDAE | Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 | 55 | 224 | 2.0E-07 |
| sp|Q6PH57|GBB1_DANRE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Danio rerio GN=gnb1 PE=2 SV=1 | 65 | 161 | 2.0E-07 |
| sp|Q2UFN8|SCONB_ASPOR | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sconB PE=3 SV=1 | 59 | 160 | 2.0E-07 |
| sp|Q2UFN8|SCONB_ASPOR | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sconB PE=3 SV=1 | 71 | 155 | 2.0E-07 |
| sp|Q26544|WSL17_SCHMA | WD repeat-containing protein SL1-17 OS=Schistosoma mansoni PE=2 SV=1 | 1 | 202 | 2.0E-07 |
| sp|B8NGT5|SCONB_ASPFN | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=sconB PE=3 SV=1 | 71 | 155 | 2.0E-07 |
| sp|B8NGT5|SCONB_ASPFN | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=sconB PE=3 SV=1 | 59 | 160 | 2.0E-07 |
| sp|P0CS42|LIS1_CRYNJ | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 | 55 | 205 | 2.0E-07 |
| sp|P0CS43|LIS1_CRYNB | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 | 55 | 205 | 2.0E-07 |
| sp|Q8W1K8|MUT11_CHLRE | Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 | 60 | 206 | 2.0E-07 |
| sp|Q58D20|NLE1_BOVIN | Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 | 60 | 154 | 2.0E-07 |
| sp|C4Q0P6|LIS1_SCHMA | Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 | 55 | 157 | 2.0E-07 |
| sp|Q7ZW33|UTP15_DANRE | U3 small nucleolar RNA-associated protein 15 homolog OS=Danio rerio GN=utp15 PE=2 SV=1 | 61 | 253 | 2.0E-07 |
| sp|C4YFX2|TUP1_CANAW | Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1 | 96 | 156 | 2.0E-07 |
| sp|P0CY34|TUP1_CANAL | Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1 | 96 | 156 | 2.0E-07 |
| sp|P62882|GBB5_RAT | Guanine nucleotide-binding protein subunit beta-5 OS=Rattus norvegicus GN=Gnb5 PE=2 SV=1 | 55 | 211 | 2.0E-07 |
| sp|Q9NVX2|NLE1_HUMAN | Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 | 60 | 154 | 2.0E-07 |
| sp|Q8N136|DAW1_HUMAN | Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 | 60 | 158 | 2.0E-07 |
| sp|Q8CBE3|WDR37_MOUSE | WD repeat-containing protein 37 OS=Mus musculus GN=Wdr37 PE=1 SV=1 | 98 | 207 | 2.0E-07 |
| sp|C5JD40|LIS1_AJEDS | Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=PAC1 PE=3 SV=1 | 65 | 158 | 2.0E-07 |
| sp|C5GVJ9|LIS1_AJEDR | Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=PAC1 PE=3 SV=1 | 65 | 158 | 2.0E-07 |
| sp|Q8I0F4|LIS1_DICDI | Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1 | 43 | 181 | 3.0E-07 |
| sp|Q8YV57|Y2124_NOSS1 | Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 | 42 | 261 | 3.0E-07 |
| sp|Q4V7Z1|POC1B_XENLA | POC1 centriolar protein homolog B OS=Xenopus laevis GN=poc1b PE=1 SV=1 | 75 | 229 | 3.0E-07 |
| sp|Q6NZH4|LIS1_XENTR | Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 | 60 | 156 | 3.0E-07 |
| sp|Q90ZL4|LIS1_XENLA | Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 | 60 | 156 | 3.0E-07 |
| sp|A1C7E4|SCONB_ASPCL | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sconB PE=3 SV=1 | 71 | 155 | 3.0E-07 |
| sp|C4YFX2|TUP1_CANAW | Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1 | 65 | 227 | 3.0E-07 |
| sp|P0CY34|TUP1_CANAL | Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1 | 65 | 227 | 3.0E-07 |
| sp|Q8N136|DAW1_HUMAN | Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 | 60 | 206 | 3.0E-07 |
| sp|Q5RFF8|NLE1_PONAB | Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 | 60 | 154 | 3.0E-07 |
| sp|P62881|GBB5_MOUSE | Guanine nucleotide-binding protein subunit beta-5 OS=Mus musculus GN=Gnb5 PE=1 SV=1 | 55 | 211 | 3.0E-07 |
| sp|O88879|APAF_MOUSE | Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3 | 52 | 163 | 3.0E-07 |
| sp|Q8C092|TAF5_MOUSE | Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 | 53 | 161 | 3.0E-07 |
| sp|Q8IZU2|WDR17_HUMAN | WD repeat-containing protein 17 OS=Homo sapiens GN=WDR17 PE=2 SV=2 | 47 | 157 | 3.0E-07 |
| sp|C5PFX0|LIS1_COCP7 | Nuclear distribution protein PAC1 OS=Coccidioides posadasii (strain C735) GN=PAC1 PE=3 SV=2 | 64 | 182 | 3.0E-07 |
| sp|Q80ZD0|GBB5_TAMST | Guanine nucleotide-binding protein subunit beta-5 OS=Tamias striatus GN=GNB5 PE=2 SV=1 | 55 | 211 | 3.0E-07 |
| sp|Q5RDY7|GBB5_PONAB | Guanine nucleotide-binding protein subunit beta-5 OS=Pongo abelii GN=GNB5 PE=2 SV=1 | 55 | 211 | 3.0E-07 |
| sp|B8PD53|LIS12_POSPM | Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 | 57 | 181 | 3.0E-07 |
| sp|Q8YTC2|Y2800_NOSS1 | Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 | 48 | 156 | 4.0E-07 |
| sp|Q4RJN5|LIS1_TETNG | Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 | 60 | 156 | 4.0E-07 |
| sp|D3BUN1|LIS1_POLPA | Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1 | 43 | 181 | 4.0E-07 |
| sp|Q3Y8L7|DAW1_CHLRE | Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 | 72 | 224 | 4.0E-07 |
| sp|Q42384|PRL1_ARATH | Protein pleiotropic regulatory locus 1 OS=Arabidopsis thaliana GN=PRL1 PE=1 SV=1 | 46 | 255 | 4.0E-07 |
| sp|B6Q4Z5|SCONB_TALMQ | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=sconB PE=3 SV=1 | 71 | 211 | 4.0E-07 |
| sp|P25387|GBLP_CHLRE | Guanine nucleotide-binding protein subunit beta-like protein OS=Chlamydomonas reinhardtii GN=GBLP PE=2 SV=1 | 59 | 158 | 4.0E-07 |
| sp|Q15542|TAF5_HUMAN | Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 | 53 | 161 | 4.0E-07 |
| sp|Q6C709|PRP46_YARLI | Pre-mRNA-splicing factor PRP46 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP46 PE=3 SV=2 | 39 | 156 | 4.0E-07 |
| sp|O18640|GBLP_DROME | Guanine nucleotide-binding protein subunit beta-like protein OS=Drosophila melanogaster GN=Rack1 PE=1 SV=2 | 60 | 158 | 4.0E-07 |
| sp|Q6PNB6|GBB5_RABIT | Guanine nucleotide-binding protein subunit beta-5 OS=Oryctolagus cuniculus GN=GNB5 PE=2 SV=1 | 55 | 207 | 4.0E-07 |
| sp|Q9Y2I8|WDR37_HUMAN | WD repeat-containing protein 37 OS=Homo sapiens GN=WDR37 PE=1 SV=2 | 98 | 207 | 4.0E-07 |
| sp|Q5R650|WDR37_PONAB | WD repeat-containing protein 37 OS=Pongo abelii GN=WDR37 PE=2 SV=1 | 98 | 207 | 4.0E-07 |
| sp|B4JWA1|LIS1_DROGR | Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 | 50 | 157 | 4.0E-07 |
| sp|P42527|MHCKA_DICDI | Myosin heavy chain kinase A OS=Dictyostelium discoideum GN=mhkA PE=1 SV=2 | 60 | 207 | 4.0E-07 |
| sp|Q00808|HETE1_PODAS | Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 | 59 | 157 | 4.0E-07 |
| sp|B6GZD3|LIS12_PENRW | Nuclear distribution protein nudF 2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-2 PE=3 SV=1 | 68 | 193 | 4.0E-07 |
| sp|Q39190|PRL2_ARATH | Protein pleiotropic regulator PRL2 OS=Arabidopsis thaliana GN=PRL2 PE=2 SV=2 | 46 | 273 | 4.0E-07 |
| sp|A2QCU8|SCONB_ASPNC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sconB PE=3 SV=1 | 71 | 283 | 4.0E-07 |
| sp|P49026|GBLP_TOBAC | Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana tabacum GN=ARCA PE=2 SV=1 | 65 | 213 | 4.0E-07 |
| sp|O14435|GBB_CRYPA | Guanine nucleotide-binding protein subunit beta OS=Cryphonectria parasitica GN=GB-1 PE=3 SV=1 | 59 | 205 | 4.0E-07 |
| sp|P0CS49|PRP46_CRYNB | Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP46 PE=3 SV=1 | 45 | 208 | 4.0E-07 |
| sp|P17343|GBB1_CAEEL | Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis elegans GN=gpb-1 PE=1 SV=2 | 65 | 210 | 4.0E-07 |
| sp|Q61ZF6|GBB1_CAEBR | Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis briggsae GN=gpb-1 PE=3 SV=1 | 65 | 210 | 4.0E-07 |
| sp|B8P4B0|LIS11_POSPM | Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1 | 57 | 181 | 4.0E-07 |
| sp|Q6DDF0|WDR37_XENLA | WD repeat-containing protein 37 OS=Xenopus laevis GN=wdr37 PE=2 SV=1 | 98 | 207 | 4.0E-07 |
| sp|O14775|GBB5_HUMAN | Guanine nucleotide-binding protein subunit beta-5 OS=Homo sapiens GN=GNB5 PE=2 SV=2 | 55 | 211 | 4.0E-07 |
| sp|Q6S7B0|TAF5_ARATH | Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 | 57 | 161 | 4.0E-07 |
| sp|P78706|RCO1_NEUCR | Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2 | 65 | 156 | 4.0E-07 |
| sp|Q9M2Z2|WDR5A_ARATH | COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 | 60 | 154 | 5.0E-07 |
| sp|Q1LV15|DAW1_DANRE | Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 | 60 | 161 | 5.0E-07 |
| sp|Q91854|TRCB_XENLA | Beta-TrCP OS=Xenopus laevis GN=fbxw1 PE=2 SV=1 | 60 | 253 | 5.0E-07 |
| sp|Q17963|WDR51_CAEEL | WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 | 51 | 255 | 5.0E-07 |
| sp|Q54N86|FBXAL_DICDI | F-box/WD repeat-containing protein A-like protein OS=Dictyostelium discoideum GN=DDB_G0285445 PE=3 SV=1 | 54 | 181 | 5.0E-07 |
| sp|P0CS44|MDV1_CRYNJ | Mitochondrial division protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MDV1 PE=3 SV=1 | 61 | 207 | 5.0E-07 |
| sp|P0CS44|MDV1_CRYNJ | Mitochondrial division protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MDV1 PE=3 SV=1 | 65 | 252 | 5.0E-07 |
| sp|P0CS45|MDV1_CRYNB | Mitochondrial division protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MDV1 PE=3 SV=1 | 61 | 207 | 5.0E-07 |
| sp|P0CS45|MDV1_CRYNB | Mitochondrial division protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MDV1 PE=3 SV=1 | 65 | 252 | 5.0E-07 |
| sp|P49846|TAF5_DROME | Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1 | 59 | 173 | 5.0E-07 |
| sp|A4IIX9|WDR37_XENTR | WD repeat-containing protein 37 OS=Xenopus tropicalis GN=wdr37 PE=2 SV=1 | 98 | 207 | 5.0E-07 |
| sp|C7Z6H2|LIS1_NECH7 | Nuclear distribution protein PAC1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=PAC1 PE=3 SV=1 | 90 | 174 | 5.0E-07 |
| sp|O00628|PEX7_HUMAN | Peroxisomal targeting signal 2 receptor OS=Homo sapiens GN=PEX7 PE=1 SV=1 | 72 | 167 | 5.0E-07 |
| sp|P0CS48|PRP46_CRYNJ | Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP46 PE=3 SV=1 | 45 | 208 | 5.0E-07 |
| sp|A4RJV3|MDV1_MAGO7 | Mitochondrial division protein 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MDV1 PE=3 SV=3 | 66 | 158 | 5.0E-07 |
| sp|O94365|UTP15_SCHPO | U3 small nucleolar RNA-associated protein 15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp15 PE=3 SV=1 | 49 | 207 | 5.0E-07 |
| sp|Q7ZXK9|NLE1_XENLA | Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 | 60 | 154 | 5.0E-07 |
| sp|B4LQ21|LIS1_DROVI | Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 | 60 | 156 | 5.0E-07 |
| sp|P43034|LIS1_HUMAN | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2 | 60 | 156 | 6.0E-07 |
| sp|Q9PTR5|LIS1_CHICK | Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3 | 60 | 156 | 6.0E-07 |
| sp|Q9SY00|WDR5B_ARATH | COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 | 70 | 207 | 6.0E-07 |
| sp|B4JWA1|LIS1_DROGR | Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 | 60 | 156 | 6.0E-07 |
| sp|Q54N86|FBXAL_DICDI | F-box/WD repeat-containing protein A-like protein OS=Dictyostelium discoideum GN=DDB_G0285445 PE=3 SV=1 | 106 | 214 | 6.0E-07 |
| sp|Q39336|GBLP_BRANA | Guanine nucleotide-binding protein subunit beta-like protein OS=Brassica napus GN=GB1 PE=2 SV=1 | 65 | 208 | 6.0E-07 |
| sp|Q0U1B1|LIS1_PHANO | Nuclear distribution protein PAC1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAC1 PE=3 SV=1 | 55 | 182 | 6.0E-07 |
| sp|Q9AUR7|COPA2_ORYSJ | Coatomer subunit alpha-2 OS=Oryza sativa subsp. japonica GN=Os03g0711500 PE=2 SV=1 | 61 | 167 | 6.0E-07 |
| sp|Q8HXX0|LIS1_MACFA | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3 | 60 | 156 | 7.0E-07 |
| sp|P63004|LIS1_RAT | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2 | 60 | 156 | 7.0E-07 |
| sp|P63005|LIS1_MOUSE | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2 | 60 | 156 | 7.0E-07 |
| sp|B0LSW3|LIS1_FELCA | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1 | 60 | 156 | 7.0E-07 |
| sp|P43033|LIS1_BOVIN | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 | 60 | 156 | 7.0E-07 |
| sp|Q9GL51|LIS1_PIG | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 | 60 | 156 | 7.0E-07 |
| sp|Q5REG7|LIS1_PONAB | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 | 60 | 156 | 7.0E-07 |
| sp|O74855|NLE1_SCHPO | Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 | 55 | 154 | 7.0E-07 |
| sp|Q00808|HETE1_PODAS | Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 | 60 | 170 | 7.0E-07 |
| sp|C4JZS6|LIS11_UNCRE | Nuclear distribution protein PAC1-1 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-1 PE=3 SV=1 | 98 | 182 | 7.0E-07 |
| sp|Q2UGU1|LIS1_ASPOR | Nuclear distribution protein nudF OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nudF PE=3 SV=2 | 59 | 227 | 7.0E-07 |
| sp|B8N9H4|LIS1_ASPFN | Nuclear distribution protein nudF OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=nudF PE=3 SV=2 | 59 | 227 | 7.0E-07 |
| sp|G0SEA3|GLE2_CHATD | Nucleoporin GLE2 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=GLE2 PE=3 SV=1 | 24 | 253 | 7.0E-07 |
| sp|F1MNN4|FBXW7_BOVIN | F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2 | 60 | 253 | 8.0E-07 |
| sp|B7PS00|LIS1_IXOSC | Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 | 44 | 181 | 8.0E-07 |
| sp|Q6CB13|MDV1_YARLI | Mitochondrial division protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MDV1 PE=3 SV=1 | 65 | 253 | 8.0E-07 |
| sp|B4MY65|LIS1_DROWI | Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 | 50 | 157 | 8.0E-07 |
| sp|B6QC06|LIS12_TALMQ | Nuclear distribution protein nudF 2 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-2 PE=3 SV=1 | 98 | 182 | 8.0E-07 |
| sp|Q93847|YZLL_CAEEL | Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1 | 96 | 206 | 8.0E-07 |
| sp|Q8VBV4|FBXW7_MOUSE | F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1 | 60 | 253 | 9.0E-07 |
| sp|Q9AV81|PRP19_ORYSJ | Pre-mRNA-processing factor 19 OS=Oryza sativa subsp. japonica GN=PRP19 PE=2 SV=1 | 44 | 211 | 9.0E-07 |
| sp|O24456|GBLPA_ARATH | Receptor for activated C kinase 1A OS=Arabidopsis thaliana GN=RACK1A PE=1 SV=2 | 65 | 208 | 9.0E-07 |
| sp|Q4R8E7|DAW1_MACFA | Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 | 60 | 204 | 9.0E-07 |
| sp|Q5GIS3|GBB_PINFU | Guanine nucleotide-binding protein subunit beta OS=Pinctada fucata PE=1 SV=1 | 65 | 161 | 9.0E-07 |
| sp|Q8I0F4|LIS1_DICDI | Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1 | 55 | 157 | 1.0E-06 |
| sp|Q969H0|FBXW7_HUMAN | F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1 | 68 | 253 | 1.0E-06 |
| sp|B3S4I5|LIS1_TRIAD | Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 | 59 | 157 | 1.0E-06 |
| sp|A8X8C6|TG125_CAEBR | WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 | 51 | 209 | 1.0E-06 |
| sp|B6GZA1|SCONB_PENRW | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=sconB PE=3 SV=1 | 71 | 271 | 1.0E-06 |
| sp|O75529|TAF5L_HUMAN | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 | 60 | 253 | 1.0E-06 |
| sp|B8PD53|LIS12_POSPM | Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 | 43 | 253 | 1.0E-06 |
| sp|Q00808|HETE1_PODAS | Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 | 59 | 254 | 1.0E-06 |
| sp|Q00808|HETE1_PODAS | Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 | 60 | 169 | 1.0E-06 |
| sp|Q7ZXK9|NLE1_XENLA | Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 | 67 | 155 | 1.0E-06 |
| sp|Q4R8E7|DAW1_MACFA | Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 | 60 | 253 | 1.0E-06 |
| sp|P07834|CDC4_YEAST | Cell division control protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC4 PE=1 SV=2 | 76 | 211 | 1.0E-06 |
| sp|Q9JJA4|WDR12_MOUSE | Ribosome biogenesis protein WDR12 OS=Mus musculus GN=Wdr12 PE=1 SV=1 | 72 | 206 | 1.0E-06 |
| sp|Q12417|PRP46_YEAST | Pre-mRNA-splicing factor PRP46 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP46 PE=1 SV=1 | 46 | 202 | 1.0E-06 |
| sp|Q09715|TUP11_SCHPO | Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1 | 61 | 207 | 1.0E-06 |
| sp|O13615|PRP46_SCHPO | Pre-mRNA-splicing factor prp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp5 PE=1 SV=1 | 43 | 206 | 1.0E-06 |
| sp|Q8R537|PEX7_CRIGR | Peroxisomal targeting signal 2 receptor OS=Cricetulus griseus GN=PEX7 PE=1 SV=1 | 72 | 167 | 1.0E-06 |
| sp|Q54YD8|COPB2_DICDI | Coatomer subunit beta' OS=Dictyostelium discoideum GN=copb2 PE=3 SV=1 | 76 | 165 | 1.0E-06 |
| sp|Q0CY32|SCONB_ASPTN | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sconB PE=3 SV=1 | 71 | 155 | 1.0E-06 |
| sp|B8M7Q5|SCONB_TALSN | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sconB PE=3 SV=1 | 60 | 207 | 1.0E-06 |
| sp|B8M7Q5|SCONB_TALSN | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sconB PE=3 SV=1 | 71 | 155 | 1.0E-06 |
| sp|P26308|GBB1_DROME | Guanine nucleotide-binding protein subunit beta-1 OS=Drosophila melanogaster GN=Gbeta13F PE=1 SV=1 | 65 | 161 | 1.0E-06 |
| sp|P53621|COPA_HUMAN | Coatomer subunit alpha OS=Homo sapiens GN=COPA PE=1 SV=2 | 77 | 191 | 1.0E-06 |
| sp|Q8TED0|UTP15_HUMAN | U3 small nucleolar RNA-associated protein 15 homolog OS=Homo sapiens GN=UTP15 PE=1 SV=3 | 61 | 253 | 1.0E-06 |
| sp|P97865|PEX7_MOUSE | Peroxisomal targeting signal 2 receptor OS=Mus musculus GN=Pex7 PE=1 SV=1 | 72 | 167 | 1.0E-06 |
| sp|P93107|PF20_CHLRE | Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1 | 73 | 253 | 1.0E-06 |
| sp|D1ZEB4|LIS11_SORMK | Nuclear distribution protein PAC1-1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-1 PE=3 SV=1 | 92 | 182 | 1.0E-06 |
| sp|P62884|GBLP_LEIIN | Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania infantum GN=LACK1 PE=2 SV=1 | 77 | 208 | 1.0E-06 |
| sp|P62883|GBLP_LEICH | Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania chagasi PE=2 SV=1 | 77 | 208 | 1.0E-06 |
| sp|Q25306|GBLP_LEIMA | Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania major PE=2 SV=1 | 77 | 208 | 1.0E-06 |
| sp|Q8JZX3|POC1A_MOUSE | POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 | 75 | 253 | 2.0E-06 |
| sp|F6ZT52|POC1B_XENTR | POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1 | 75 | 229 | 2.0E-06 |
| sp|Q803D2|LIS1B_DANRE | Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 | 60 | 156 | 2.0E-06 |
| sp|O13282|TAF5_SCHPO | Transcription initiation factor TFIID subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf5 PE=1 SV=1 | 57 | 156 | 2.0E-06 |
| sp|Q00808|HETE1_PODAS | Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 | 60 | 156 | 2.0E-06 |
| sp|B8P4B0|LIS11_POSPM | Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1 | 42 | 253 | 2.0E-06 |
| sp|P78706|RCO1_NEUCR | Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2 | 77 | 209 | 2.0E-06 |
| sp|B4LQ21|LIS1_DROVI | Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 | 50 | 157 | 2.0E-06 |
| sp|B7PS00|LIS1_IXOSC | Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 | 55 | 157 | 2.0E-06 |
| sp|B4MY65|LIS1_DROWI | Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 | 60 | 156 | 2.0E-06 |
| sp|Q0CY32|SCONB_ASPTN | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sconB PE=3 SV=1 | 59 | 160 | 2.0E-06 |
| sp|B2VWG7|LIS1_PYRTR | Nuclear distribution protein PAC1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=pac1 PE=3 SV=1 | 4 | 182 | 2.0E-06 |
| sp|B4KT48|LIS1_DROMO | Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1 | 50 | 157 | 2.0E-06 |
| sp|Q229Z6|POC1_TETTS | POC1 centriolar protein homolog OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_01308010 PE=3 SV=1 | 74 | 157 | 2.0E-06 |
| sp|Q6H8D6|COB23_ORYSJ | Putative coatomer subunit beta'-3 OS=Oryza sativa subsp. japonica GN=Os02g0209000 PE=3 SV=2 | 77 | 154 | 2.0E-06 |
| sp|Q7RY30|LIS11_NEUCR | Nuclear distribution protein nudF-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-1 PE=3 SV=2 | 92 | 182 | 2.0E-06 |
| sp|Q96WV5|COPA_SCHPO | Putative coatomer subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPJ4664.04 PE=1 SV=1 | 65 | 235 | 2.0E-06 |
| sp|P61480|WDR12_RAT | Ribosome biogenesis protein WDR12 OS=Rattus norvegicus GN=Wdr12 PE=2 SV=1 | 72 | 206 | 2.0E-06 |
| sp|Q09855|POF11_SCHPO | F-box/WD repeat-containing protein pof11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof11 PE=1 SV=2 | 60 | 208 | 2.0E-06 |
| sp|Q291L9|LIS1_DROPS | Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1 | 60 | 156 | 2.0E-06 |
| sp|B4GAJ1|LIS1_DROPE | Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1 | 60 | 156 | 2.0E-06 |
| sp|Q9FLX9|NLE1_ARATH | Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1 | 53 | 154 | 2.0E-06 |
| sp|Q08706|GBB_LYMST | Guanine nucleotide-binding protein subunit beta OS=Lymnaea stagnalis PE=2 SV=1 | 65 | 161 | 2.0E-06 |
| sp|D5GBI7|LIS1_TUBMM | Nuclear distribution protein PAC1 OS=Tuber melanosporum (strain Mel28) GN=PAC1 PE=3 SV=1 | 92 | 174 | 2.0E-06 |
| sp|A4R3M4|LIS1_MAGO7 | Nuclear distribution protein PAC1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAC1 PE=3 SV=3 | 98 | 182 | 2.0E-06 |
| sp|A7MB12|UTP15_BOVIN | U3 small nucleolar RNA-associated protein 15 homolog OS=Bos taurus GN=UTP15 PE=2 SV=1 | 61 | 253 | 2.0E-06 |
| sp|Q5REE6|WDR12_PONAB | Ribosome biogenesis protein WDR12 OS=Pongo abelii GN=WDR12 PE=2 SV=1 | 77 | 206 | 2.0E-06 |
| sp|Q9GZL7|WDR12_HUMAN | Ribosome biogenesis protein WDR12 OS=Homo sapiens GN=WDR12 PE=1 SV=2 | 77 | 206 | 2.0E-06 |
| sp|Q5BK30|DAW1_RAT | Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 | 60 | 161 | 2.0E-06 |
| sp|Q0VC24|WDR12_BOVIN | Ribosome biogenesis protein WDR12 OS=Bos taurus GN=WDR12 PE=2 SV=1 | 77 | 206 | 2.0E-06 |
| sp|Q0J3D9|COPA3_ORYSJ | Coatomer subunit alpha-3 OS=Oryza sativa subsp. japonica GN=Os09g0127800 PE=2 SV=1 | 61 | 167 | 2.0E-06 |
| sp|B3MEY6|LIS1_DROAN | Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 | 50 | 157 | 2.0E-06 |
| sp|A8XZJ9|LIS1_CAEBR | Lissencephaly-1 homolog OS=Caenorhabditis briggsae GN=lis-1 PE=3 SV=2 | 60 | 208 | 2.0E-06 |
| sp|Q8YTC2|Y2800_NOSS1 | Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 | 48 | 253 | 3.0E-06 |
| sp|Q7ZUV2|KTNB1_DANRE | Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 | 53 | 154 | 3.0E-06 |
| sp|B5X3C4|LIS1B_SALSA | Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 | 60 | 156 | 3.0E-06 |
| sp|C4Q0P6|LIS1_SCHMA | Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 | 61 | 208 | 3.0E-06 |
| sp|O88879|APAF_MOUSE | Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3 | 60 | 194 | 3.0E-06 |
| sp|Q8C092|TAF5_MOUSE | Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 | 59 | 207 | 3.0E-06 |
| sp|Q15542|TAF5_HUMAN | Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 | 59 | 207 | 3.0E-06 |
| sp|A2QCU8|SCONB_ASPNC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sconB PE=3 SV=1 | 59 | 160 | 3.0E-06 |
| sp|P78706|RCO1_NEUCR | Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2 | 60 | 167 | 3.0E-06 |
| sp|Q09715|TUP11_SCHPO | Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1 | 64 | 156 | 3.0E-06 |
| sp|B3MEY6|LIS1_DROAN | Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 | 60 | 156 | 3.0E-06 |
| sp|B4P6P9|LIS1_DROYA | Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 | 50 | 157 | 3.0E-06 |
| sp|B4P6P9|LIS1_DROYA | Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 | 60 | 156 | 3.0E-06 |
| sp|B3NPW0|LIS1_DROER | Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 | 50 | 157 | 3.0E-06 |
| sp|B3NPW0|LIS1_DROER | Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 | 60 | 156 | 3.0E-06 |
| sp|B4QHG6|LIS1_DROSI | Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1 | 60 | 156 | 3.0E-06 |
| sp|B4QHG6|LIS1_DROSI | Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1 | 55 | 157 | 3.0E-06 |
| sp|B4HSL3|LIS1_DROSE | Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1 | 60 | 156 | 3.0E-06 |
| sp|B4HSL3|LIS1_DROSE | Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1 | 55 | 157 | 3.0E-06 |
| sp|Q7KNS3|LIS1_DROME | Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2 | 60 | 156 | 3.0E-06 |
| sp|Q7KNS3|LIS1_DROME | Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2 | 55 | 157 | 3.0E-06 |
| sp|O74184|WAT1_SCHPO | WD repeat-containing protein wat1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wat1 PE=1 SV=1 | 55 | 266 | 3.0E-06 |
| sp|Q9AUR8|COPA1_ORYSJ | Coatomer subunit alpha-1 OS=Oryza sativa subsp. japonica GN=Os03g0711400 PE=2 SV=1 | 61 | 167 | 3.0E-06 |
| sp|Q6NLV4|FY_ARATH | Flowering time control protein FY OS=Arabidopsis thaliana GN=FY PE=1 SV=1 | 55 | 162 | 3.0E-06 |
| sp|C1GB49|LIS1_PARBD | Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1 | 65 | 158 | 3.0E-06 |
| sp|C0S902|LIS1_PARBP | Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PAC1 PE=3 SV=2 | 65 | 158 | 3.0E-06 |
| sp|Q8BH57|WDR48_MOUSE | WD repeat-containing protein 48 OS=Mus musculus GN=Wdr48 PE=1 SV=1 | 94 | 253 | 3.0E-06 |
| sp|Q8CIE6|COPA_MOUSE | Coatomer subunit alpha OS=Mus musculus GN=Copa PE=1 SV=2 | 77 | 191 | 3.0E-06 |
| sp|Q61011|GBB3_MOUSE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Mus musculus GN=Gnb3 PE=1 SV=2 | 65 | 161 | 3.0E-06 |
| sp|Q8L828|COB23_ARATH | Coatomer subunit beta'-3 OS=Arabidopsis thaliana GN=At3g15980 PE=2 SV=1 | 95 | 154 | 3.0E-06 |
| sp|O14727|APAF_HUMAN | Apoptotic protease-activating factor 1 OS=Homo sapiens GN=APAF1 PE=1 SV=2 | 60 | 194 | 3.0E-06 |
| sp|Q27954|COPA_BOVIN | Coatomer subunit alpha OS=Bos taurus GN=COPA PE=1 SV=1 | 77 | 191 | 3.0E-06 |
| sp|Q2UG43|SEC13_ASPOR | Protein transport protein sec13 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sec13 PE=3 SV=1 | 73 | 161 | 3.0E-06 |
| sp|Q9EPV5|APAF_RAT | Apoptotic protease-activating factor 1 OS=Rattus norvegicus GN=Apaf1 PE=1 SV=1 | 61 | 163 | 3.0E-06 |
| sp|B6HP56|LIS11_PENRW | Nuclear distribution protein nudF 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-1 PE=3 SV=1 | 65 | 158 | 3.0E-06 |
| sp|P52287|GBB3_RAT | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Rattus norvegicus GN=Gnb3 PE=1 SV=1 | 65 | 161 | 3.0E-06 |
| sp|P54313|GBB2_RAT | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Rattus norvegicus GN=Gnb2 PE=1 SV=4 | 65 | 161 | 3.0E-06 |
| sp|P62880|GBB2_MOUSE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Mus musculus GN=Gnb2 PE=1 SV=3 | 65 | 161 | 3.0E-06 |
| sp|P62879|GBB2_HUMAN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Homo sapiens GN=GNB2 PE=1 SV=3 | 65 | 161 | 3.0E-06 |
| sp|P11017|GBB2_BOVIN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Bos taurus GN=GNB2 PE=2 SV=3 | 65 | 161 | 3.0E-06 |
| sp|B5X3Z6|LIS1A_SALSA | Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 | 99 | 206 | 4.0E-06 |
| sp|Q5IS43|LIS1_PANTR | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3 | 60 | 156 | 4.0E-06 |
| sp|Q91WQ5|TAF5L_MOUSE | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 | 60 | 253 | 4.0E-06 |
| sp|Q8H0T9|KTNB1_ARATH | Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 | 72 | 252 | 4.0E-06 |
| sp|A1CF18|LIS12_ASPCL | Nuclear distribution protein nudF 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-2 PE=3 SV=1 | 98 | 158 | 4.0E-06 |
| sp|C4Q0P6|LIS1_SCHMA | Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 | 48 | 206 | 4.0E-06 |
| sp|D1ZEB4|LIS11_SORMK | Nuclear distribution protein PAC1-1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-1 PE=3 SV=1 | 60 | 157 | 4.0E-06 |
| sp|Q7RY30|LIS11_NEUCR | Nuclear distribution protein nudF-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-1 PE=3 SV=2 | 60 | 157 | 4.0E-06 |
| sp|Q291L9|LIS1_DROPS | Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1 | 50 | 157 | 4.0E-06 |
| sp|B4GAJ1|LIS1_DROPE | Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1 | 50 | 157 | 4.0E-06 |
| sp|Q9UTC7|YIDC_SCHPO | Uncharacterized WD repeat-containing protein C227.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.12 PE=3 SV=1 | 72 | 253 | 4.0E-06 |
| sp|B5DG67|WDR12_SALSA | Ribosome biogenesis protein wdr12 OS=Salmo salar GN=wdr12 PE=2 SV=1 | 72 | 206 | 4.0E-06 |
| sp|Q6H8D5|COB22_ORYSJ | Coatomer subunit beta'-2 OS=Oryza sativa subsp. japonica GN=Os02g0209100 PE=2 SV=1 | 77 | 154 | 4.0E-06 |
| sp|P41318|LST8_YEAST | Target of rapamycin complex subunit LST8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LST8 PE=1 SV=1 | 75 | 265 | 4.0E-06 |
| sp|Q54MP8|Y5837_DICDI | Bromodomain and WD repeat-containing DDB_G0285837 OS=Dictyostelium discoideum GN=DDB_G0285837 PE=3 SV=1 | 35 | 211 | 4.0E-06 |
| sp|Q4WLM7|LIS1_ASPFU | Nuclear distribution protein nudF OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nudF PE=3 SV=1 | 4 | 190 | 4.0E-06 |
| sp|B0XM00|LIS1_ASPFC | Nuclear distribution protein nudF OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=nudF PE=3 SV=1 | 4 | 190 | 4.0E-06 |
| sp|Q8C7V3|UTP15_MOUSE | U3 small nucleolar RNA-associated protein 15 homolog OS=Mus musculus GN=Utp15 PE=1 SV=1 | 48 | 253 | 4.0E-06 |
| sp|P79147|GBB3_CANLF | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Canis lupus familiaris GN=GNB3 PE=2 SV=1 | 65 | 161 | 4.0E-06 |
| sp|A2RRU3|UTP15_RAT | U3 small nucleolar RNA-associated protein 15 homolog OS=Rattus norvegicus GN=Utp15 PE=2 SV=1 | 48 | 253 | 4.0E-06 |
| sp|Q54D08|LST8_DICDI | Protein LST8 homolog OS=Dictyostelium discoideum GN=lst8 PE=1 SV=1 | 72 | 158 | 4.0E-06 |
| sp|Q9M2Z2|WDR5A_ARATH | COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 | 55 | 208 | 5.0E-06 |
| sp|Q9BVA0|KTNB1_HUMAN | Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 | 53 | 148 | 5.0E-06 |
| sp|Q8BG40|KTNB1_MOUSE | Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 | 53 | 148 | 5.0E-06 |
| sp|Q8VEJ4|NLE1_MOUSE | Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 | 67 | 156 | 5.0E-06 |
| sp|Q58D20|NLE1_BOVIN | Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 | 67 | 156 | 5.0E-06 |
| sp|C4Q0P6|LIS1_SCHMA | Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 | 60 | 156 | 5.0E-06 |
| sp|Q9NVX2|NLE1_HUMAN | Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 | 67 | 156 | 5.0E-06 |
| sp|Q5RFF8|NLE1_PONAB | Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 | 67 | 156 | 5.0E-06 |
| sp|A1CUD6|LIS11_ASPCL | Nuclear distribution protein nudF 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-1 PE=3 SV=1 | 17 | 158 | 5.0E-06 |
| sp|Q19124|A16L1_CAEEL | Autophagic-related protein 16.1 OS=Caenorhabditis elegans GN=atg-16.1 PE=3 SV=1 | 96 | 167 | 5.0E-06 |
| sp|Q8N9V3|WSDU1_HUMAN | WD repeat, SAM and U-box domain-containing protein 1 OS=Homo sapiens GN=WDSUB1 PE=1 SV=3 | 77 | 154 | 5.0E-06 |
| sp|Q9SJT9|COPA2_ARATH | Coatomer subunit alpha-2 OS=Arabidopsis thaliana GN=At2g21390 PE=2 SV=1 | 61 | 167 | 5.0E-06 |
| sp|P69104|GBLP_TRYBR | Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei rhodesiense PE=2 SV=1 | 77 | 158 | 5.0E-06 |
| sp|P69103|GBLP_TRYBB | Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei brucei PE=2 SV=1 | 77 | 158 | 5.0E-06 |
| sp|Q5NVD0|PRP4_PONAB | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Pongo abelii GN=PRPF4 PE=2 SV=1 | 65 | 154 | 5.0E-06 |
| sp|A8Q2R5|WDR48_BRUMA | WD repeat-containing protein 48 homolog OS=Brugia malayi GN=Bm1_41555 PE=3 SV=2 | 72 | 206 | 5.0E-06 |
| sp|O43172|PRP4_HUMAN | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens GN=PRPF4 PE=1 SV=2 | 65 | 154 | 5.0E-06 |
| sp|C5FWH1|LIS1_ARTOC | Nuclear distribution protein PAC1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PAC1 PE=3 SV=1 | 4 | 182 | 5.0E-06 |
| sp|P90648|MHCKB_DICDI | Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1 | 45 | 154 | 6.0E-06 |
| sp|P87053|POF1_SCHPO | F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof1 PE=1 SV=1 | 33 | 215 | 6.0E-06 |
| sp|B5X3C4|LIS1B_SALSA | Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 | 99 | 206 | 6.0E-06 |
| sp|Q229Z6|POC1_TETTS | POC1 centriolar protein homolog OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_01308010 PE=3 SV=1 | 96 | 243 | 6.0E-06 |
| sp|P38123|SWD3_YEAST | COMPASS component SWD3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWD3 PE=1 SV=1 | 55 | 206 | 6.0E-06 |
| sp|Q3MHE2|PRP4_BOVIN | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Bos taurus GN=PRPF4 PE=2 SV=1 | 65 | 154 | 6.0E-06 |
| sp|Q20636|GBB2_CAEEL | Guanine nucleotide-binding protein subunit beta-2 OS=Caenorhabditis elegans GN=gpb-2 PE=1 SV=2 | 65 | 156 | 6.0E-06 |
| sp|Q9DAW6|PRP4_MOUSE | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Mus musculus GN=Prpf4 PE=1 SV=1 | 65 | 154 | 6.0E-06 |
| sp|O13982|YEC8_SCHPO | Uncharacterized WD repeat-containing protein C25H1.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25H1.08c PE=3 SV=1 | 20 | 181 | 6.0E-06 |
| sp|O48847|LUH_ARATH | Transcriptional corepressor LEUNIG_HOMOLOG OS=Arabidopsis thaliana GN=LUH PE=1 SV=1 | 96 | 208 | 6.0E-06 |
| sp|Q09406|A16L2_CAEEL | Autophagic-related protein 16.2 OS=Caenorhabditis elegans GN=atg-16.2 PE=3 SV=2 | 80 | 157 | 6.0E-06 |
| sp|Q7S7N3|HAT2_NEUCR | Histone acetyltransferase type B subunit 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hat-2 PE=3 SV=2 | 60 | 158 | 6.0E-06 |
| sp|Q6CKE8|PRP46_KLULA | Pre-mRNA-splicing factor PRP46 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PRP46 PE=3 SV=1 | 53 | 207 | 6.0E-06 |
| sp|Q09855|POF11_SCHPO | F-box/WD repeat-containing protein pof11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof11 PE=1 SV=2 | 96 | 276 | 7.0E-06 |
| sp|C1GB49|LIS1_PARBD | Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1 | 57 | 181 | 7.0E-06 |
| sp|C0S902|LIS1_PARBP | Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PAC1 PE=3 SV=2 | 57 | 181 | 7.0E-06 |
| sp|Q9Y263|PLAP_HUMAN | Phospholipase A-2-activating protein OS=Homo sapiens GN=PLAA PE=1 SV=2 | 64 | 210 | 7.0E-06 |
| sp|Q5VQ78|COB21_ORYSJ | Coatomer subunit beta'-1 OS=Oryza sativa subsp. japonica GN=Os06g0143900 PE=2 SV=1 | 77 | 154 | 7.0E-06 |
| sp|Q5BE22|PRP46_EMENI | Pre-mRNA-splicing factor prp46 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp46 PE=3 SV=1 | 53 | 208 | 7.0E-06 |
| sp|Q0U2T3|MDV1_PHANO | Mitochondrial division protein 1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=MDV1 PE=3 SV=2 | 66 | 158 | 7.0E-06 |
| sp|Q6NX08|WDR12_DANRE | Ribosome biogenesis protein wdr12 OS=Danio rerio GN=wdr12 PE=2 SV=1 | 72 | 206 | 7.0E-06 |
| sp|Q1LZ08|WDR48_DROME | WD repeat-containing protein 48 homolog OS=Drosophila melanogaster GN=CG9062 PE=2 SV=1 | 55 | 210 | 7.0E-06 |
| sp|Q54KL5|WDR5_DICDI | WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 | 65 | 210 | 8.0E-06 |
| sp|P90648|MHCKB_DICDI | Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1 | 45 | 181 | 8.0E-06 |
| sp|Q8YTC2|Y2800_NOSS1 | Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 | 55 | 155 | 8.0E-06 |
| sp|C3XVT5|LIS1_BRAFL | Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 | 60 | 156 | 8.0E-06 |
| sp|Q09990|LIN23_CAEEL | F-box/WD repeat-containing protein lin-23 OS=Caenorhabditis elegans GN=lin-23 PE=1 SV=2 | 60 | 253 | 8.0E-06 |
| sp|Q17N69|LIS1_AEDAE | Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 | 67 | 181 | 8.0E-06 |
| sp|O00628|PEX7_HUMAN | Peroxisomal targeting signal 2 receptor OS=Homo sapiens GN=PEX7 PE=1 SV=1 | 60 | 263 | 8.0E-06 |
| sp|Q2UGU1|LIS1_ASPOR | Nuclear distribution protein nudF OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nudF PE=3 SV=2 | 80 | 158 | 8.0E-06 |
| sp|B8N9H4|LIS1_ASPFN | Nuclear distribution protein nudF OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=nudF PE=3 SV=2 | 80 | 158 | 8.0E-06 |
| sp|A4R3M4|LIS1_MAGO7 | Nuclear distribution protein PAC1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAC1 PE=3 SV=3 | 59 | 227 | 8.0E-06 |
| sp|A8XZJ9|LIS1_CAEBR | Lissencephaly-1 homolog OS=Caenorhabditis briggsae GN=lis-1 PE=3 SV=2 | 76 | 206 | 8.0E-06 |
| sp|B3MET8|WDR48_DROAN | WD repeat-containing protein 48 homolog OS=Drosophila ananassae GN=GF12420 PE=3 SV=1 | 55 | 210 | 8.0E-06 |
| sp|B4QB64|WDR48_DROSI | WD repeat-containing protein 48 homolog OS=Drosophila simulans GN=GD25924 PE=3 SV=1 | 55 | 210 | 8.0E-06 |
| sp|Q54SD4|RBBD_DICDI | Probable histone-binding protein rbbD OS=Dictyostelium discoideum GN=rbbD PE=3 SV=1 | 71 | 209 | 8.0E-06 |
| sp|A8NEG8|LIS1_COPC7 | Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 | 70 | 253 | 9.0E-06 |
| sp|Q3Y8L7|DAW1_CHLRE | Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 | 60 | 156 | 9.0E-06 |
| sp|Q0P593|DAW1_BOVIN | Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 | 72 | 207 | 9.0E-06 |
| sp|B7FNU7|LIS1_PHATC | Lissencephaly-1 homolog OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_17300 PE=3 SV=1 | 99 | 287 | 9.0E-06 |
| sp|B4P7H8|WDR48_DROYA | WD repeat-containing protein 48 homolog OS=Drosophila yakuba GN=GE13034 PE=3 SV=1 | 55 | 210 | 9.0E-06 |
| sp|B3NSK1|WDR48_DROER | WD repeat-containing protein 48 homolog OS=Drosophila erecta GN=GG22678 PE=3 SV=1 | 55 | 210 | 9.0E-06 |
| sp|Q10282|GBB_SCHPO | Guanine nucleotide-binding protein subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=git5 PE=3 SV=2 | 65 | 161 | 9.0E-06 |
| sp|A1DP19|LIS1_NEOFI | Nuclear distribution protein nudF OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nudF PE=3 SV=1 | 17 | 158 | 9.0E-06 |
| sp|B4HND9|WDR48_DROSE | WD repeat-containing protein 48 homolog OS=Drosophila sechellia GN=GM20456 PE=3 SV=1 | 55 | 210 | 9.0E-06 |
| sp|Q4ICM0|LIS1_GIBZE | Nuclear distribution protein PAC1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PAC1 PE=3 SV=2 | 92 | 158 | 9.0E-06 |
| sp|Q8C4J7|TBL3_MOUSE | Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1 | 42 | 207 | 9.0E-06 |
| sp|P25382|NLE1_YEAST | Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 | 60 | 157 | 9.0E-06 |
| sp|O61585|KTNB1_STRPU | Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 | 55 | 155 | 1.0E-05 |
| sp|Q94A40|COPA1_ARATH | Coatomer subunit alpha-1 OS=Arabidopsis thaliana GN=At1g62020 PE=2 SV=2 | 61 | 167 | 1.0E-05 |
| sp|Q54S79|WDR3_DICDI | WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1 | 60 | 224 | 1.0E-05 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0005515 | protein binding | Yes |
| GO:0003674 | molecular_function | No |
| GO:0005488 | binding | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 12 | 0.45 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Agabi119p4|604000 MALPDTSNFLVSEAHLLLDEARKEKSERIKDLGEPIRLQGKAIDIIIQGGIAWIAESTATVKKIDLETGKSLQVY RGHTAPVTTLTFCDAVPGCGDRKILVTGSWDKTIKLWDTESRRLISSTDAHQDFVKVLYVFPTVGLLVSGSSDKT VRFWDVSQPSERRLLPSLGSISSHSRPVECIQGNVTTNGTIILYTGDTMGVIKVWELSRESGSNPRWKASLKQHL DYHRTRINDIHYGNGQLWTASADETVQVSIDPDLMTEPKIKLPRPIIHPKQVRCILPIGLTDGL* |
| Coding | >Agabi119p4|604000 ATGGCCTTACCTGACACATCGAATTTTCTTGTCTCCGAAGCTCATCTCCTCTTGGATGAAGCCAGAAAGGAAAAA TCAGAACGGATAAAGGATCTCGGAGAGCCGATACGCTTGCAGGGTAAAGCTATTGATATAATTATCCAAGGTGGA ATCGCGTGGATTGCAGAAAGCACGGCTACTGTGAAAAAGATAGATCTTGAAACTGGGAAGTCGTTACAGGTTTAT AGGGGGCATACTGCTCCCGTAACGACACTTACATTCTGTGACGCTGTTCCTGGGTGCGGTGATCGCAAAATTCTA GTTACTGGATCTTGGGATAAGACCATCAAGTTATGGGACACCGAAAGTAGAAGATTGATATCATCCACCGACGCG CACCAGGATTTCGTGAAGGTGTTGTATGTCTTCCCAACAGTGGGTTTACTGGTCTCGGGAAGTTCAGACAAAACT GTCCGATTCTGGGACGTCTCTCAACCAAGTGAACGCCGCCTCCTGCCCAGTCTCGGTTCGATATCATCTCATTCG CGACCTGTGGAATGCATTCAGGGAAACGTTACCACTAATGGTACAATTATATTATACACCGGTGACACCATGGGC GTCATCAAGGTCTGGGAGCTGTCGAGAGAATCAGGAAGCAATCCACGTTGGAAAGCTTCGCTCAAACAGCACCTC GACTATCATCGTACCAGAATCAATGACATTCACTATGGCAACGGACAGCTCTGGACAGCCTCAGCGGACGAGACT GTACAAGTCAGCATCGATCCCGATCTAATGACCGAGCCCAAAATTAAGTTGCCCCGGCCTATAATACATCCTAAA CAGGTCCGCTGCATTCTTCCAATTGGCCTCACTGACGGTCTATGA |
| Transcript | >Agabi119p4|604000 ATGGCCTTACCTGACACATCGAATTTTCTTGTCTCCGAAGCTCATCTCCTCTTGGATGAAGCCAGAAAGGAAAAA TCAGAACGGATAAAGGATCTCGGAGAGCCGATACGCTTGCAGGGTAAAGCTATTGATATAATTATCCAAGGTGGA ATCGCGTGGATTGCAGAAAGCACGGCTACTGTGAAAAAGATAGATCTTGAAACTGGGAAGTCGTTACAGGTTTAT AGGGGGCATACTGCTCCCGTAACGACACTTACATTCTGTGACGCTGTTCCTGGGTGCGGTGATCGCAAAATTCTA GTTACTGGATCTTGGGATAAGACCATCAAGTTATGGGACACCGAAAGTAGAAGATTGATATCATCCACCGACGCG CACCAGGATTTCGTGAAGGTGTTGTATGTCTTCCCAACAGTGGGTTTACTGGTCTCGGGAAGTTCAGACAAAACT GTCCGATTCTGGGACGTCTCTCAACCAAGTGAACGCCGCCTCCTGCCCAGTCTCGGTTCGATATCATCTCATTCG CGACCTGTGGAATGCATTCAGGGAAACGTTACCACTAATGGTACAATTATATTATACACCGGTGACACCATGGGC GTCATCAAGGTCTGGGAGCTGTCGAGAGAATCAGGAAGCAATCCACGTTGGAAAGCTTCGCTCAAACAGCACCTC GACTATCATCGTACCAGAATCAATGACATTCACTATGGCAACGGACAGCTCTGGACAGCCTCAGCGGACGAGACT GTACAAGTCAGCATCGATCCCGATCTAATGACCGAGCCCAAAATTAAGTTGCCCCGGCCTATAATACATCCTAAA CAGGTCCGCTGCATTCTTCCAATTGGCCTCACTGACGGTCTATGA |
| Gene | >Agabi119p4|604000 ATGGCCTTACCTGACACATCGAATTTTCTTGTCTCCGAAGCTCATCTCCTCTTGGATGAAGTGTGTCTTCGCCTA TATTTAAGCAAACAGCTACAGACATTGTACAAAGGCCAGAAAGGAAAAATCAGAACGGATAAAGGATCTCGGAGA GCCGATACGCTTGCAGGGTAAAGCTATTGATATAATTATCCAAGGTGGAATCGCGTGGATTGCAGAAAGCACGGC TACTGTGAAAAAGATAGATCTTGAAGTTCGTAGTATTTTCTTCGTAAAGTTCGACTGAACGAGCCACCACTTCAT TTCCTCTCCAATCAGACTGGGAAGTCGTTACAGGTTTATAGGGGGCATACTGCTCCCGTAACGACACTTACATTC TGTGACGCTGTTCCTGGGTGCGGTGATCGCAAAATTCTAGTTACTGGATCTTGGGATAAGGTCTGCAAAAAGTTC TAGGCAACACACTATCTCCTCACTGATACACACCACCTTCAGACCATCAAGTTATGGGACACCGAAGTAAATGAT CCATTCAGTCCCTCGGTTTCATCGACTGACTTCCAATTTCAGAGTAGAAGATTGATATCATCCACCGACGCGCAC CAGGATTTCGTGAAGGTGTTGTATGTCTTCCCAACAGTGGGTTTACTGGTCTCGGGAAGTTCAGACAAAACTGTC CGATTCTGGTATGAACATTCTTTCTGCCGCTCTATTGAATTGACCTATCCTGCAAAGGGACGTCTCTCAACCAAG TGAACGCCGCCTCCTGCCCAGTCTCGGTTCGATATCATCTCATTCGCGACCTGTGGAATGCATTCAGGGAAACGT TACCACTAATGGTACAATTATATTATACACCGGTGACACCATGGGCGTCATCAAGGTCTGGGAGCTGTCGAGAGA ATCAGGAAGCAATCCACGTTGGAAAGCTTCGCTCAAACAGCACCTCGACTATCATCGTACCAGAATCAATGACAT TCACTATGGCAACGGACAGCTCTGGACAGGTATATCTAATATCTATCTCTCGCATTACCTGTCACTTACTACAAT TCATCTAGCCTCAGCGGACGAGACTGTACAAGTCAGCATCGATCCCGATCTAATGACCGAGCCCAAAATTAAGTT GCCCCGGCCTATAATACATCCTAAACAGGTCCGCTGCATTCTTCCAATTGGCCTCACTGACGTGAGCGAGCCATA CCTGATTACCGGTTCCGACGGTACCATCAGGGTCTATGA |