Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|603650
Gene name
Locationscaffold_03a:1476665..1477748
Strand+
Gene length (bp)1083
Transcript length (bp)1038
Coding sequence length (bp)1038
Protein length (aa) 346

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13880 Acetyltransf_13 ESCO1/2 acetyl-transferase 6.5E-18 276 337
PF13878 zf-C2H2_3 zinc-finger of acetyl-transferase ESCO 2.8E-10 78 113

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O42917|ESO1_SCHPO N-acetyltransferase eso1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=eso1 PE=1 SV=1 65 335 2.0E-18
sp|Q6C668|ECO1_YARLI N-acetyltransferase ECO1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ECO1 PE=3 SV=1 67 345 2.0E-15
sp|Q5FWF5|ESCO1_HUMAN N-acetyltransferase ESCO1 OS=Homo sapiens GN=ESCO1 PE=1 SV=3 90 339 6.0E-13
sp|Q69Z69|ESCO1_MOUSE N-acetyltransferase ESCO1 OS=Mus musculus GN=Esco1 PE=2 SV=2 90 339 7.0E-13
sp|A7UL74|CTF7_ARATH Protein CHROMOSOME TRANSMISSION FIDELITY 7 OS=Arabidopsis thaliana GN=CTF7 PE=1 SV=1 75 337 3.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O42917|ESO1_SCHPO N-acetyltransferase eso1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=eso1 PE=1 SV=1 65 335 2.0E-18
sp|Q6C668|ECO1_YARLI N-acetyltransferase ECO1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ECO1 PE=3 SV=1 67 345 2.0E-15
sp|Q5FWF5|ESCO1_HUMAN N-acetyltransferase ESCO1 OS=Homo sapiens GN=ESCO1 PE=1 SV=3 90 339 6.0E-13
sp|Q69Z69|ESCO1_MOUSE N-acetyltransferase ESCO1 OS=Mus musculus GN=Esco1 PE=2 SV=2 90 339 7.0E-13
sp|A7UL74|CTF7_ARATH Protein CHROMOSOME TRANSMISSION FIDELITY 7 OS=Arabidopsis thaliana GN=CTF7 PE=1 SV=1 75 337 3.0E-10
sp|Q56NI9|ESCO2_HUMAN N-acetyltransferase ESCO2 OS=Homo sapiens GN=ESCO2 PE=1 SV=1 91 335 6.0E-10
sp|Q5SPR8|ESCO2_DANRE N-acetyltransferase ESCO2 OS=Danio rerio GN=esco2 PE=2 SV=1 90 335 2.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 61 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|603650
MHVKHTYSSRVSSQRKPDSASSTSVVAKRKRPLEEVLTTASSNVPTIPPMKRQRKLSVGNAAYKKKQKPSSSSSS
LTQLHFSIDKSTLRTCPLCNLSYTKGAPEDESLHRTHCVRVQRGMEWGKEEERESSKIGVVEVASQVKVGKSGKR
GRIISCPVDCSGKIGSKISALLQTINLSLSSPALRQECIRNCKIYMFLLPQTSANPGSSSLGSSREKIVGCVVAQ
RISSAMAIAEEEVKVNDDADNGDKENLGRGGHLVMVDSGTGLFCHPEPLPTPMGVPRLFVPSTYRRQGIASALLD
AAAANFIHGCPLDPRKGQVAFTQPTGDGKALMVRWGGGGARIYEE*
Coding >Agabi119p4|603650
ATGCACGTCAAACACACATATAGCTCTCGAGTCTCTTCGCAACGAAAGCCTGATAGCGCATCTTCAACTTCTGTA
GTGGCTAAGCGTAAACGACCTTTGGAAGAGGTATTAACGACAGCTTCGAGCAATGTTCCAACCATTCCTCCCATG
AAGCGCCAAAGAAAGCTGTCTGTTGGGAATGCTGCCTACAAGAAGAAACAAAAGCCGTCGTCATCATCATCATCA
TTGACTCAACTCCACTTCTCAATCGACAAAAGCACACTTCGTACTTGTCCATTGTGCAATTTGTCTTATACCAAA
GGGGCACCTGAAGATGAAAGTCTTCATCGGACGCATTGCGTGCGGGTACAAAGAGGCATGGAATGGGGGAAAGAG
GAGGAAAGGGAAAGTTCCAAGATTGGAGTTGTCGAAGTTGCGAGTCAGGTTAAAGTTGGAAAAAGTGGCAAACGC
GGAAGAATCATTTCATGTCCCGTGGATTGTTCAGGCAAAATTGGCTCCAAGATATCCGCTCTTTTACAAACTATT
AATTTAAGCCTATCTTCACCAGCGTTAAGACAAGAATGTATCCGAAATTGCAAGATATACATGTTTCTTCTGCCG
CAAACGTCTGCGAATCCAGGTAGTTCTAGTCTCGGTTCCAGCCGAGAAAAGATTGTGGGTTGCGTTGTGGCACAA
AGAATATCCAGCGCGATGGCAATTGCTGAAGAAGAAGTGAAGGTAAACGATGATGCTGATAATGGAGATAAAGAG
AATCTGGGACGAGGGGGACATCTAGTCATGGTCGACAGTGGGACGGGCTTATTCTGTCACCCGGAACCCCTTCCG
ACACCTATGGGTGTTCCGCGGTTATTCGTGCCGTCAACATACCGACGGCAAGGAATAGCGAGTGCACTACTGGAT
GCGGCTGCGGCAAATTTTATACATGGATGTCCTCTTGATCCGAGGAAGGGACAGGTGGCATTTACACAGCCGACG
GGGGATGGAAAGGCGCTAATGGTCAGATGGGGGGGAGGCGGTGCGAGGATTTATGAAGAGTGA
Transcript >Agabi119p4|603650
ATGCACGTCAAACACACATATAGCTCTCGAGTCTCTTCGCAACGAAAGCCTGATAGCGCATCTTCAACTTCTGTA
GTGGCTAAGCGTAAACGACCTTTGGAAGAGGTATTAACGACAGCTTCGAGCAATGTTCCAACCATTCCTCCCATG
AAGCGCCAAAGAAAGCTGTCTGTTGGGAATGCTGCCTACAAGAAGAAACAAAAGCCGTCGTCATCATCATCATCA
TTGACTCAACTCCACTTCTCAATCGACAAAAGCACACTTCGTACTTGTCCATTGTGCAATTTGTCTTATACCAAA
GGGGCACCTGAAGATGAAAGTCTTCATCGGACGCATTGCGTGCGGGTACAAAGAGGCATGGAATGGGGGAAAGAG
GAGGAAAGGGAAAGTTCCAAGATTGGAGTTGTCGAAGTTGCGAGTCAGGTTAAAGTTGGAAAAAGTGGCAAACGC
GGAAGAATCATTTCATGTCCCGTGGATTGTTCAGGCAAAATTGGCTCCAAGATATCCGCTCTTTTACAAACTATT
AATTTAAGCCTATCTTCACCAGCGTTAAGACAAGAATGTATCCGAAATTGCAAGATATACATGTTTCTTCTGCCG
CAAACGTCTGCGAATCCAGGTAGTTCTAGTCTCGGTTCCAGCCGAGAAAAGATTGTGGGTTGCGTTGTGGCACAA
AGAATATCCAGCGCGATGGCAATTGCTGAAGAAGAAGTGAAGGTAAACGATGATGCTGATAATGGAGATAAAGAG
AATCTGGGACGAGGGGGACATCTAGTCATGGTCGACAGTGGGACGGGCTTATTCTGTCACCCGGAACCCCTTCCG
ACACCTATGGGTGTTCCGCGGTTATTCGTGCCGTCAACATACCGACGGCAAGGAATAGCGAGTGCACTACTGGAT
GCGGCTGCGGCAAATTTTATACATGGATGTCCTCTTGATCCGAGGAAGGGACAGGTGGCATTTACACAGCCGACG
GGGGATGGAAAGGCGCTAATGGTCAGATGGGGGGGAGGCGGTGCGAGGATTTATGAAGAGTGA
Gene >Agabi119p4|603650
ATGCACGTCAAACACACATATAGCTCTCGAGTCTCTTCGCAACGAAAGCCTGATAGCGCATCTTCAACTTCTGTA
GTGGCTAAGCGTAAACGACCTTTGGAAGAGGTATTAACGACAGCTTCGAGCAATGTTCCAACCATTCCTCCCATG
AAGCGCCAAAGAAAGCTGTCTGTTGGGAATGCTGCCTACAAGAAGAAACAAAAGCCGTCGTCATCATCATCATCA
TTGACTCAACTCCACTTCTCAATCGACAAAAGCACACTTCGTACTTGTCCATTGTGCAATTTGTCTTATACCAAA
GGGGCACCTGAAGATGAAAGTCTTCATCGGACGCATTGCGTGCGGGTACAAAGAGGCATGGAATGGGGGAAAGAG
GAGGAAAGGGAAAGTTCCAAGATTGGAGTTGTCGAAGTTGCGAGTCAGGTTAAAGTTGGAAAAAGTGGCAAACGC
GGAAGAATCATTTCATGTCCCGTGGATTGTTCAGGCAAAATTGGCTCCAAGGTCCGTATACAACACAAATGCTAC
ATATTTACTAATGTTCTACAGATATCCGCTCTTTTACAAACTATTAATTTAAGCCTATCTTCACCAGCGTTAAGA
CAAGAATGTATCCGAAATTGCAAGATATACATGTTTCTTCTGCCGCAAACGTCTGCGAATCCAGGTAGTTCTAGT
CTCGGTTCCAGCCGAGAAAAGATTGTGGGTTGCGTTGTGGCACAAAGAATATCCAGCGCGATGGCAATTGCTGAA
GAAGAAGTGAAGGTAAACGATGATGCTGATAATGGAGATAAAGAGAATCTGGGACGAGGGGGACATCTAGTCATG
GTCGACAGTGGGACGGGCTTATTCTGTCACCCGGAACCCCTTCCGACACCTATGGGTGTTCCGCGGTTATTCGTG
CCGTCAACATACCGACGGCAAGGAATAGCGAGTGCACTACTGGATGCGGCTGCGGCAAATTTTATACATGGATGT
CCTCTTGATCCGAGGAAGGGACAGGTGGCATTTACACAGCCGACGGGGGATGGAAAGGCGCTAATGGTCAGATGG
GGGGGAGGCGGTGCGAGGATTTATGAAGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail