Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|602150
Gene name
Locationscaffold_03a:940294..940954
Strand+
Gene length (bp)660
Transcript length (bp)660
Coding sequence length (bp)660
Protein length (aa) 220

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07823 CPDase Cyclic phosphodiesterase-like protein 4.3E-18 28 217
PF13563 2_5_RNA_ligase2 2'-5' RNA ligase superfamily 1.9E-09 44 160

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O04147|CPD_ARATH Cyclic phosphodiesterase OS=Arabidopsis thaliana GN=At4g18930 PE=1 SV=1 27 161 1.0E-06

GO

GO Term Description Terminal node
GO:0004112 cyclic-nucleotide phosphodiesterase activity Yes
GO:0016787 hydrolase activity No
GO:0042578 phosphoric ester hydrolase activity No
GO:0003824 catalytic activity No
GO:0008081 phosphoric diester hydrolase activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|602150
MDKSFSKPSSSNVETVHRLITQLAAQFGLWIMPPRNVAEDLKEIMNIRRDRPYSADTYPRFEPHITLAAIKSDTP
ISLSTIRESIPTAQRAFPVKFESVNIGDHYFRSVYASIKLDEALLDLHKTLHENLDKVPKTPKYPHMSLVYVSDE
DAVEGEREKYYEELKERQLIAAASSGGVQLRVSPEKEWIGGFLAAEIWVMRCVGPVESWEVLDKIALPH*
Coding >Agabi119p4|602150
ATGGACAAGTCGTTCAGTAAGCCGAGTTCTTCCAACGTGGAAACTGTACACAGGCTTATCACACAACTGGCAGCC
CAGTTCGGTCTCTGGATCATGCCTCCTCGCAACGTGGCAGAAGATCTCAAAGAAATCATGAACATTCGAAGAGAC
CGACCTTACTCAGCCGACACCTATCCTCGTTTTGAACCCCATATTACTCTCGCAGCCATCAAATCTGACACACCT
ATTTCATTATCGACTATTCGCGAATCGATACCCACTGCCCAGCGTGCGTTTCCAGTCAAATTTGAATCAGTCAAC
ATTGGCGACCATTATTTTCGCTCGGTCTATGCTTCTATAAAGTTAGACGAGGCTTTGTTGGATTTGCACAAGACT
TTGCATGAAAACCTGGATAAAGTTCCAAAAACACCAAAGTATCCTCATATGTCACTTGTGTATGTGAGTGATGAG
GATGCGGTGGAGGGAGAAAGGGAGAAATACTACGAGGAGCTGAAAGAGAGACAATTAATAGCTGCTGCCTCGAGT
GGAGGTGTACAACTACGTGTCAGCCCTGAGAAAGAGTGGATTGGCGGGTTTCTTGCTGCAGAGATCTGGGTTATG
AGGTGTGTCGGACCAGTTGAGAGTTGGGAAGTTCTAGATAAGATTGCCCTTCCTCACTAA
Transcript >Agabi119p4|602150
ATGGACAAGTCGTTCAGTAAGCCGAGTTCTTCCAACGTGGAAACTGTACACAGGCTTATCACACAACTGGCAGCC
CAGTTCGGTCTCTGGATCATGCCTCCTCGCAACGTGGCAGAAGATCTCAAAGAAATCATGAACATTCGAAGAGAC
CGACCTTACTCAGCCGACACCTATCCTCGTTTTGAACCCCATATTACTCTCGCAGCCATCAAATCTGACACACCT
ATTTCATTATCGACTATTCGCGAATCGATACCCACTGCCCAGCGTGCGTTTCCAGTCAAATTTGAATCAGTCAAC
ATTGGCGACCATTATTTTCGCTCGGTCTATGCTTCTATAAAGTTAGACGAGGCTTTGTTGGATTTGCACAAGACT
TTGCATGAAAACCTGGATAAAGTTCCAAAAACACCAAAGTATCCTCATATGTCACTTGTGTATGTGAGTGATGAG
GATGCGGTGGAGGGAGAAAGGGAGAAATACTACGAGGAGCTGAAAGAGAGACAATTAATAGCTGCTGCCTCGAGT
GGAGGTGTACAACTACGTGTCAGCCCTGAGAAAGAGTGGATTGGCGGGTTTCTTGCTGCAGAGATCTGGGTTATG
AGGTGTGTCGGACCAGTTGAGAGTTGGGAAGTTCTAGATAAGATTGCCCTTCCTCACTAA
Gene >Agabi119p4|602150
ATGGACAAGTCGTTCAGTAAGCCGAGTTCTTCCAACGTGGAAACTGTACACAGGCTTATCACACAACTGGCAGCC
CAGTTCGGTCTCTGGATCATGCCTCCTCGCAACGTGGCAGAAGATCTCAAAGAAATCATGAACATTCGAAGAGAC
CGACCTTACTCAGCCGACACCTATCCTCGTTTTGAACCCCATATTACTCTCGCAGCCATCAAATCTGACACACCT
ATTTCATTATCGACTATTCGCGAATCGATACCCACTGCCCAGCGTGCGTTTCCAGTCAAATTTGAATCAGTCAAC
ATTGGCGACCATTATTTTCGCTCGGTCTATGCTTCTATAAAGTTAGACGAGGCTTTGTTGGATTTGCACAAGACT
TTGCATGAAAACCTGGATAAAGTTCCAAAAACACCAAAGTATCCTCATATGTCACTTGTGTATGTGAGTGATGAG
GATGCGGTGGAGGGAGAAAGGGAGAAATACTACGAGGAGCTGAAAGAGAGACAATTAATAGCTGCTGCCTCGAGT
GGAGGTGTACAACTACGTGTCAGCCCTGAGAAAGAGTGGATTGGCGGGTTTCTTGCTGCAGAGATCTGGGTTATG
AGGTGTGTCGGACCAGTTGAGAGTTGGGAAGTTCTAGATAAGATTGCCCTTCCTCACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail