Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|601400
Gene name
Locationscaffold_03a:750029..755924
Strand-
Gene length (bp)5895
Transcript length (bp)4851
Coding sequence length (bp)4851
Protein length (aa) 1617

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00141 peroxidase Peroxidase 1.4E-23 65 214
PF16686 POT1PC ssDNA-binding domain of telomere protection protein 1.1E-06 1165 1287
PF16686 POT1PC ssDNA-binding domain of telomere protection protein 1.9E-10 1301 1429
PF02765 POT1 Telomeric single stranded DNA binding POT1/CDC13 4.7E-15 973 1092

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 9 334 1.0E-44
sp|Q7XZP5|APX5_ARATH L-ascorbate peroxidase 5, peroxisomal OS=Arabidopsis thaliana GN=APX5 PE=1 SV=2 60 277 2.0E-13
sp|Q8GY91|APX6_ARATH Putative L-ascorbate peroxidase 6 OS=Arabidopsis thaliana GN=APX6 PE=2 SV=1 55 202 2.0E-13
sp|Q42564|APX3_ARATH L-ascorbate peroxidase 3, peroxisomal OS=Arabidopsis thaliana GN=APX3 PE=1 SV=1 74 274 9.0E-12
sp|Q4WPF8|CCPR_ASPFU Cytochrome c peroxidase, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ccp1 PE=3 SV=1 67 202 2.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 9 334 1.0E-44
sp|Q7XZP5|APX5_ARATH L-ascorbate peroxidase 5, peroxisomal OS=Arabidopsis thaliana GN=APX5 PE=1 SV=2 60 277 2.0E-13
sp|Q8GY91|APX6_ARATH Putative L-ascorbate peroxidase 6 OS=Arabidopsis thaliana GN=APX6 PE=2 SV=1 55 202 2.0E-13
sp|Q42564|APX3_ARATH L-ascorbate peroxidase 3, peroxisomal OS=Arabidopsis thaliana GN=APX3 PE=1 SV=1 74 274 9.0E-12
sp|Q4WPF8|CCPR_ASPFU Cytochrome c peroxidase, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ccp1 PE=3 SV=1 67 202 2.0E-10
sp|P0C0V3|CCPR_EMENI Cytochrome c peroxidase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ccp1 PE=3 SV=1 67 202 6.0E-09
sp|Q1PER6|APX2_ARATH L-ascorbate peroxidase 2, cytosolic OS=Arabidopsis thaliana GN=APX2 PE=2 SV=3 74 261 1.0E-08
sp|A4QVH4|CCPR_MAGO7 Cytochrome c peroxidase, mitochondrial OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CCP1 PE=3 SV=1 67 278 1.0E-08
sp|Q6C0Z6|CCPR_YARLI Cytochrome c peroxidase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CCP1 PE=3 SV=1 67 255 2.0E-08
sp|Q6ZJJ1|APX4_ORYSJ Probable L-ascorbate peroxidase 4 OS=Oryza sativa subsp. japonica GN=APX4 PE=2 SV=1 74 202 2.0E-08
sp|P0CP55|CCPR_CRYNB Cytochrome c peroxidase, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CCP1 PE=3 SV=1 74 202 4.0E-08
sp|Q6CAB5|CCPR2_YARLI Putative cytochrome c peroxidase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0D04268g PE=3 SV=1 67 202 4.0E-08
sp|P0CP54|CCPR_CRYNJ Cytochrome c peroxidase, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CCP1 PE=3 SV=1 74 202 4.0E-08
sp|Q7SDV9|CCPR_NEUCR Cytochrome c peroxidase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ccp-1 PE=3 SV=1 67 202 5.0E-08
sp|Q5B1Z0|CCPR2_EMENI Putative heme-binding peroxidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN5440 PE=3 SV=1 67 202 7.0E-08
sp|Q5AEN1|CCPR_CANAL Cytochrome c peroxidase, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CCP1 PE=3 SV=1 64 202 2.0E-07
sp|Q9LNL0|PER8_ARATH Peroxidase 8 OS=Arabidopsis thaliana GN=PER8 PE=2 SV=1 61 220 5.0E-07
sp|O23474|PER40_ARATH Peroxidase 40 OS=Arabidopsis thaliana GN=PER40 PE=2 SV=2 69 259 5.0E-07
sp|A2YPX3|PER2_ORYSI Peroxidase 2 OS=Oryza sativa subsp. indica GN=PRX112 PE=3 SV=2 69 314 2.0E-06
sp|Q93V93|PER44_ARATH Peroxidase 44 OS=Arabidopsis thaliana GN=PER44 PE=2 SV=1 61 202 4.0E-06
sp|Q9SD46|PER36_ARATH Peroxidase 36 OS=Arabidopsis thaliana GN=PER36 PE=2 SV=2 69 209 6.0E-06
sp|Q0D3N0|PER2_ORYSJ Peroxidase 2 OS=Oryza sativa subsp. japonica GN=PRX112 PE=2 SV=1 69 314 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0020037 heme binding Yes
GO:0006979 response to oxidative stress Yes
GO:0004601 peroxidase activity Yes
GO:0003677 DNA binding Yes
GO:0000723 telomere maintenance Yes
GO:0000781 chromosome, telomeric region Yes
GO:0043047 single-stranded telomeric DNA binding Yes
GO:0050896 response to stimulus No
GO:0044260 cellular macromolecule metabolic process No
GO:0046906 tetrapyrrole binding No
GO:0044238 primary metabolic process No
GO:0071840 cellular component organization or biogenesis No
GO:0006950 response to stress No
GO:0005488 binding No
GO:0006807 nitrogen compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0016209 antioxidant activity No
GO:1901360 organic cyclic compound metabolic process No
GO:0003676 nucleic acid binding No
GO:0042162 telomeric DNA binding No
GO:0046483 heterocycle metabolic process No
GO:0051276 chromosome organization No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0016684 oxidoreductase activity, acting on peroxide as acceptor No
GO:0098847 sequence-specific single stranded DNA binding No
GO:0006996 organelle organization No
GO:0032200 telomere organization No
GO:0016043 cellular component organization No
GO:0008150 biological_process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0110165 cellular anatomical entity No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0043565 sequence-specific DNA binding No
GO:0044237 cellular metabolic process No
GO:0098687 chromosomal region No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0003697 single-stranded DNA binding No
GO:0009987 cellular process No
GO:0097159 organic cyclic compound binding No
GO:0006259 DNA metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0016491 oxidoreductase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|601400
MLLARTSRLLADLLAAGIWCTSVSAGYSWPSPQYEALETFLYEGRRYDGSNLASLQHPCKNRSDTGASIGAEWLR
LAYHDVSTRDAEAGTGGLDGSIAYELDREENAGQAMSASLADFESFSNKYVSRSDVIAAGTIFAVASCGGPIIPF
RGGRFDAVTAASSSFSVPEPFQDFQTHLDMFRRQGFSQTEMITLVACGHTIGGVRNTDFPHIVSPKGDSEKPTLE
NFDPSPQYDNLVVQQYLDGSTNNPLVVHPNKTITSDFRIFSSDNNATMKSLSSPDAYLNSCRTVLEKMLNMVPSN
VALTDEIRLLQEKVFNVQLTLEHGELVFKASLRLAQSVGSSPSKGRVVRMFWCNRYGDDKDCSTNANVVFQAAST
QDSPEISPITERLGYYFINHQFVVKVDPSKSISLFWFESDEHDGSTPKIIDNGGSGYQFDQDRILYVPMSSQLDI
TGGDEASKVYQIVAAVRSDVSPSRVYMSGFDNAIPKHGPAITIAEDLTLNTTLSPVEGYNFYSTSIQSAGLQLTV
DLHADIDGNTYTVDFQQTYFLGSSLPYTPPTNSNITAVAQIPGESTDTNSIARSAFRGPTKVRGRVQVVASLSAR
AKIQTRQSCFRALFVSPNVMKRPRDNEDDTTNKRRRKNLASDIFDDESLSNCLCNVQGLNSAIGYFTGSVSMRWS
PGGKKFIFQLTSRCCVTLSRTHKINVTFEGDWIESMHARWGLLSIMENIQLSLDGVTSVYPQTSKQTAKLVYTDG
VMYRKMREGKETEACFINSWQLQEEQDKQEDLDWFATPTVPLNGSLSEFVRTASAAGLKSVPSPKENQTSEKHDD
DSSLSKENLPPVDEHPTKQQDVVSTATSRVPPQPASISEANVVVNAQQTTSENQSRPPLSRKQEKKAKKKLARAE
KAQREALAQLAISSGAANTATATSSSQMQVSNHLPVRVDANAQVVKLGELLPVEDNPAGWMARLRRFKGNYKMLK
DATDDKSRINIIGVVRSVKPPRLSTKSDWTSNVYLQDPSLFPDGEQYTTNDYTVNFFQRRFKEWLPQVNIGDILV
LRDIKVQNHSGNLFGVGYYDRAKWAVYSIKDECFVPPKLDQAPKEQELVDGGIKFTPFLSASEPEERYCQQLSAW
WKEKNKDSAESSGHVYSLSESTIPGRTRRQHLLLCDAGPDVEPGGYFDCTFEVVNAYQSKDYPPTLYVTDYTKNA
IVAPCQTKWCPPGLNDYIVKFELWDAAVSLAPSLVPGTYWTVRNARLKRGHDGYVEGKIVEKKFSKLEPDSEYAP
LQELLKRKKEWETANKPRQTRFEHKLLKDVGDGDYANCTVELLHASKGYDEAYLEVTDYTAHPKMSSYRYEKDWS
LDLEGLIVSVHLRDAQVQHAKTLRPGFFLNIKNLRLKDNRVQKRFQGDLGGHDVLVHRLDIHHPNDDLKALLERK
KVWQKMKDAKLVAQEQRKSSDRVLDLAKRPNLTIKELKSHPKKMLKVRVIARVVAYHPIPSVWIHAWCSKCKQRI
PDDKRACHNCQDMDHEFVRWKFRLLLRVEDRNGDAMDVVLGDQSDFLRGFEIGDYFHHPSILSSISKRLEPLLGD
SKVDQREETGKDLDNDYVGLIIARHESSRIEPMYILFDVET*
Coding >Agabi119p4|601400
ATGCTATTGGCGCGCACCAGTCGGCTCCTCGCCGACTTGCTGGCAGCAGGGATCTGGTGCACCTCGGTTTCTGCT
GGTTACTCATGGCCTTCACCGCAATACGAGGCATTGGAAACATTTTTATACGAAGGGAGGAGATACGACGGTTCG
AACTTGGCTTCGCTCCAACACCCATGCAAAAACAGGTCTGATACGGGCGCGTCAATTGGTGCTGAATGGCTGAGG
CTGGCATATCATGATGTTTCGACGCGAGATGCTGAAGCTGGGACGGGCGGGTTGGATGGATCAATTGCATACGAG
TTGGATAGAGAAGAAAATGCGGGACAGGCGATGAGCGCTAGTTTGGCCGACTTTGAATCGTTCTCTAATAAATAC
GTATCTCGATCGGATGTCATCGCCGCCGGTACAATATTCGCCGTTGCATCCTGCGGGGGTCCCATTATACCTTTT
CGTGGCGGCCGTTTCGATGCAGTCACCGCAGCTTCAAGTTCTTTTAGTGTTCCAGAACCGTTCCAGGATTTTCAG
ACTCATCTAGACATGTTCCGCCGGCAGGGATTTTCGCAGACGGAGATGATCACGTTGGTTGCTTGTGGACATACT
ATCGGTGGAGTGAGAAACACGGATTTCCCTCATATTGTTTCCCCGAAAGGCGATTCAGAGAAACCTACCCTTGAA
AACTTTGATCCTTCCCCGCAGTATGATAATCTAGTGGTGCAGCAGTATCTAGATGGCAGTACAAATAATCCGCTT
GTTGTTCATCCGAACAAGACGATTACTTCGGACTTTCGAATATTCTCAAGCGATAACAATGCGACTATGAAAAGT
TTGTCATCCCCTGATGCATATTTGAATTCATGTCGAACGGTTCTCGAGAAAATGCTCAACATGGTTCCTTCGAAT
GTCGCGCTGACAGATGAAATACGGCTCTTGCAAGAGAAAGTTTTCAATGTTCAGTTGACACTTGAACATGGGGAA
TTAGTTTTCAAGGCATCACTTCGGCTCGCTCAGTCTGTGGGCTCCAGTCCCAGTAAAGGCAGAGTTGTTCGAATG
TTCTGGTGCAACCGCTACGGAGACGACAAGGATTGTTCTACCAACGCCAATGTTGTTTTTCAGGCAGCATCTACT
CAGGACTCACCAGAAATTTCACCAATCACAGAACGACTAGGCTACTATTTCATCAACCATCAATTTGTTGTCAAA
GTCGATCCTTCAAAGTCGATTTCTCTTTTCTGGTTTGAGAGTGACGAACATGATGGTTCAACGCCAAAAATTATC
GATAATGGAGGGTCGGGGTATCAATTTGACCAAGACCGTATACTGTACGTCCCGATGTCTAGTCAGTTGGATATC
ACAGGTGGAGATGAAGCTTCCAAAGTCTATCAAATTGTCGCCGCAGTTCGCAGCGACGTCTCACCTTCTCGAGTA
TATATGTCTGGTTTTGACAATGCCATACCCAAGCATGGACCCGCGATTACTATTGCCGAGGACCTCACACTAAAT
ACAACCCTCAGTCCCGTAGAAGGCTATAATTTCTACTCTACCTCGATTCAATCTGCTGGGCTTCAGTTGACGGTC
GATTTGCATGCTGACATTGATGGTAATACTTATACGGTTGATTTCCAACAGACGTATTTTTTAGGTTCAAGTCTT
CCTTATACACCGCCGACTAATTCTAATATCACTGCTGTTGCTCAAATTCCTGGAGAATCTACTGATACTAACTCT
ATTGCGAGAAGCGCGTTTAGGGGCCCAACTAAGGTAAGGGGGCGCGTCCAAGTCGTCGCGTCATTAAGCGCACGT
GCCAAGATCCAAACGCGTCAATCTTGCTTTAGAGCGCTCTTCGTCTCTCCCAATGTCATGAAGCGACCACGCGAT
AACGAAGACGATACTACCAACAAGAGGCGGCGCAAGAATCTCGCGAGTGATATCTTCGATGACGAATCTCTCAGC
AATTGCCTCTGCAATGTTCAAGGGTTAAACAGTGCCATAGGATATTTCACTGGCTCAGTGTCTATGAGATGGTCA
CCTGGTGGCAAGAAATTCATATTCCAGTTAACGTCTCGATGCTGCGTTACACTTAGTCGAACTCACAAGATCAAC
GTTACTTTCGAGGGGGACTGGATTGAATCTATGCATGCTCGATGGGGTCTTTTGTCTATCATGGAGAACATTCAA
CTATCGCTAGATGGAGTAACTTCCGTCTATCCGCAGACTTCGAAGCAAACAGCGAAGCTGGTGTATACAGACGGT
GTCATGTATCGAAAGATGCGAGAAGGGAAAGAAACGGAGGCATGCTTCATCAATTCTTGGCAATTGCAAGAGGAA
CAAGACAAACAAGAGGATTTAGATTGGTTTGCTACGCCTACGGTACCTCTTAACGGATCTTTATCGGAGTTTGTT
CGTACGGCTTCTGCTGCTGGCCTCAAGAGTGTCCCCAGTCCAAAGGAAAACCAAACGTCTGAAAAACATGATGAT
GACTCGAGTTTGTCGAAGGAGAACCTGCCTCCCGTCGACGAACATCCAACCAAACAACAAGATGTTGTCAGTACC
GCAACTTCTAGGGTTCCCCCCCAGCCCGCATCTATCTCAGAGGCCAACGTCGTTGTAAATGCTCAACAAACGACA
AGTGAGAACCAATCGCGTCCTCCTTTGTCTCGTAAGCAAGAAAAAAAGGCGAAGAAGAAACTCGCCAGGGCGGAA
AAAGCGCAACGTGAAGCATTGGCGCAACTGGCTATATCATCTGGAGCTGCCAATACCGCGACAGCTACATCTTCA
TCTCAAATGCAAGTGAGCAATCACCTTCCGGTACGAGTTGATGCAAATGCTCAAGTCGTTAAATTGGGCGAATTA
CTACCTGTTGAAGATAATCCGGCAGGTTGGATGGCGCGTTTGCGGCGTTTCAAGGGTAATTATAAAATGCTCAAA
GATGCGACCGACGACAAAAGCCGTATAAATATTATCGGAGTAGTGAGGAGTGTTAAGCCCCCTCGTCTGTCAACC
AAAAGTGACTGGACTTCAAACGTTTATTTGCAAGACCCTAGTCTATTTCCGGATGGGGAGCAATATACTACGAAT
GACTATACCGTTAATTTCTTCCAGAGAAGGTTCAAGGAGTGGCTGCCACAAGTGAACATAGGAGATATCTTAGTT
TTGCGTGACATCAAGGTCCAAAATCACAGTGGTAACCTCTTTGGTGTTGGATATTACGACAGAGCCAAATGGGCT
GTCTATTCCATCAAAGACGAGTGCTTTGTCCCACCGAAACTAGACCAGGCCCCGAAAGAACAGGAGTTAGTAGAT
GGCGGCATCAAATTCACTCCATTTCTAAGCGCAAGTGAGCCGGAGGAGCGCTACTGCCAACAGTTGTCGGCTTGG
TGGAAAGAGAAGAACAAAGACTCAGCAGAATCGTCCGGTCATGTGTATAGCTTGAGTGAATCCACCATCCCCGGA
CGGACGCGGCGCCAGCATCTACTACTCTGCGATGCAGGACCGGATGTGGAACCTGGCGGATATTTCGACTGTACA
TTTGAGGTTGTTAATGCTTATCAGAGTAAGGATTACCCCCCTACTCTATATGTGACAGACTATACGAAAAATGCC
ATCGTTGCGCCTTGCCAGACGAAGTGGTGTCCACCTGGACTAAACGATTACATCGTGAAGTTTGAACTTTGGGAT
GCGGCAGTAAGCTTGGCCCCATCGCTTGTCCCTGGAACATATTGGACGGTTAGGAATGCTCGACTCAAGCGCGGC
CATGATGGATACGTTGAGGGGAAGATAGTCGAAAAGAAATTCTCTAAGCTTGAACCTGACTCCGAGTACGCTCCA
CTACAAGAATTGCTGAAACGCAAGAAGGAATGGGAAACCGCAAACAAACCAAGGCAAACGCGTTTTGAACACAAA
TTGCTCAAAGACGTCGGGGATGGAGATTACGCCAACTGCACCGTCGAGTTGTTGCATGCGTCCAAGGGTTATGAT
GAAGCTTATCTTGAGGTGACAGACTATACAGCCCATCCAAAGATGTCGTCCTATCGATATGAGAAGGACTGGTCC
CTGGATTTGGAAGGCCTTATTGTCAGTGTCCACCTACGTGATGCCCAGGTGCAACATGCAAAAACTTTACGTCCA
GGATTCTTCCTGAATATCAAAAACCTCCGACTGAAAGACAATCGTGTTCAAAAAAGGTTCCAGGGCGACTTGGGC
GGTCACGATGTTCTAGTTCATCGCCTCGATATCCATCATCCAAATGATGATCTCAAGGCGCTTTTGGAGCGTAAA
AAAGTTTGGCAGAAAATGAAAGATGCCAAGCTAGTAGCCCAGGAACAGCGGAAGTCAAGTGATAGAGTATTAGAT
CTCGCAAAACGACCCAATCTCACCATTAAAGAACTCAAGTCACATCCCAAAAAAATGCTCAAAGTCAGAGTGATC
GCACGTGTCGTTGCGTACCATCCAATTCCATCTGTATGGATTCACGCCTGGTGTTCGAAGTGCAAGCAAAGAATC
CCAGATGACAAGCGGGCATGCCATAATTGTCAAGACATGGACCACGAATTTGTTCGCTGGAAATTCAGGCTACTA
TTGCGGGTCGAAGACAGAAACGGGGATGCTATGGATGTTGTTCTGGGGGATCAGAGTGACTTCCTGCGAGGTTTT
GAGATAGGTGATTACTTCCATCATCCGTCCATCCTCTCAAGCATTTCAAAGCGGCTTGAACCTCTATTGGGCGAT
AGTAAAGTTGATCAGAGGGAAGAGACGGGAAAAGATCTTGACAATGATTACGTTGGGCTTATTATTGCACGTCAT
GAGAGCAGTAGAATTGAACCCATGTATATCCTATTTGATGTTGAGACTTGA
Transcript >Agabi119p4|601400
ATGCTATTGGCGCGCACCAGTCGGCTCCTCGCCGACTTGCTGGCAGCAGGGATCTGGTGCACCTCGGTTTCTGCT
GGTTACTCATGGCCTTCACCGCAATACGAGGCATTGGAAACATTTTTATACGAAGGGAGGAGATACGACGGTTCG
AACTTGGCTTCGCTCCAACACCCATGCAAAAACAGGTCTGATACGGGCGCGTCAATTGGTGCTGAATGGCTGAGG
CTGGCATATCATGATGTTTCGACGCGAGATGCTGAAGCTGGGACGGGCGGGTTGGATGGATCAATTGCATACGAG
TTGGATAGAGAAGAAAATGCGGGACAGGCGATGAGCGCTAGTTTGGCCGACTTTGAATCGTTCTCTAATAAATAC
GTATCTCGATCGGATGTCATCGCCGCCGGTACAATATTCGCCGTTGCATCCTGCGGGGGTCCCATTATACCTTTT
CGTGGCGGCCGTTTCGATGCAGTCACCGCAGCTTCAAGTTCTTTTAGTGTTCCAGAACCGTTCCAGGATTTTCAG
ACTCATCTAGACATGTTCCGCCGGCAGGGATTTTCGCAGACGGAGATGATCACGTTGGTTGCTTGTGGACATACT
ATCGGTGGAGTGAGAAACACGGATTTCCCTCATATTGTTTCCCCGAAAGGCGATTCAGAGAAACCTACCCTTGAA
AACTTTGATCCTTCCCCGCAGTATGATAATCTAGTGGTGCAGCAGTATCTAGATGGCAGTACAAATAATCCGCTT
GTTGTTCATCCGAACAAGACGATTACTTCGGACTTTCGAATATTCTCAAGCGATAACAATGCGACTATGAAAAGT
TTGTCATCCCCTGATGCATATTTGAATTCATGTCGAACGGTTCTCGAGAAAATGCTCAACATGGTTCCTTCGAAT
GTCGCGCTGACAGATGAAATACGGCTCTTGCAAGAGAAAGTTTTCAATGTTCAGTTGACACTTGAACATGGGGAA
TTAGTTTTCAAGGCATCACTTCGGCTCGCTCAGTCTGTGGGCTCCAGTCCCAGTAAAGGCAGAGTTGTTCGAATG
TTCTGGTGCAACCGCTACGGAGACGACAAGGATTGTTCTACCAACGCCAATGTTGTTTTTCAGGCAGCATCTACT
CAGGACTCACCAGAAATTTCACCAATCACAGAACGACTAGGCTACTATTTCATCAACCATCAATTTGTTGTCAAA
GTCGATCCTTCAAAGTCGATTTCTCTTTTCTGGTTTGAGAGTGACGAACATGATGGTTCAACGCCAAAAATTATC
GATAATGGAGGGTCGGGGTATCAATTTGACCAAGACCGTATACTGTACGTCCCGATGTCTAGTCAGTTGGATATC
ACAGGTGGAGATGAAGCTTCCAAAGTCTATCAAATTGTCGCCGCAGTTCGCAGCGACGTCTCACCTTCTCGAGTA
TATATGTCTGGTTTTGACAATGCCATACCCAAGCATGGACCCGCGATTACTATTGCCGAGGACCTCACACTAAAT
ACAACCCTCAGTCCCGTAGAAGGCTATAATTTCTACTCTACCTCGATTCAATCTGCTGGGCTTCAGTTGACGGTC
GATTTGCATGCTGACATTGATGGTAATACTTATACGGTTGATTTCCAACAGACGTATTTTTTAGGTTCAAGTCTT
CCTTATACACCGCCGACTAATTCTAATATCACTGCTGTTGCTCAAATTCCTGGAGAATCTACTGATACTAACTCT
ATTGCGAGAAGCGCGTTTAGGGGCCCAACTAAGGTAAGGGGGCGCGTCCAAGTCGTCGCGTCATTAAGCGCACGT
GCCAAGATCCAAACGCGTCAATCTTGCTTTAGAGCGCTCTTCGTCTCTCCCAATGTCATGAAGCGACCACGCGAT
AACGAAGACGATACTACCAACAAGAGGCGGCGCAAGAATCTCGCGAGTGATATCTTCGATGACGAATCTCTCAGC
AATTGCCTCTGCAATGTTCAAGGGTTAAACAGTGCCATAGGATATTTCACTGGCTCAGTGTCTATGAGATGGTCA
CCTGGTGGCAAGAAATTCATATTCCAGTTAACGTCTCGATGCTGCGTTACACTTAGTCGAACTCACAAGATCAAC
GTTACTTTCGAGGGGGACTGGATTGAATCTATGCATGCTCGATGGGGTCTTTTGTCTATCATGGAGAACATTCAA
CTATCGCTAGATGGAGTAACTTCCGTCTATCCGCAGACTTCGAAGCAAACAGCGAAGCTGGTGTATACAGACGGT
GTCATGTATCGAAAGATGCGAGAAGGGAAAGAAACGGAGGCATGCTTCATCAATTCTTGGCAATTGCAAGAGGAA
CAAGACAAACAAGAGGATTTAGATTGGTTTGCTACGCCTACGGTACCTCTTAACGGATCTTTATCGGAGTTTGTT
CGTACGGCTTCTGCTGCTGGCCTCAAGAGTGTCCCCAGTCCAAAGGAAAACCAAACGTCTGAAAAACATGATGAT
GACTCGAGTTTGTCGAAGGAGAACCTGCCTCCCGTCGACGAACATCCAACCAAACAACAAGATGTTGTCAGTACC
GCAACTTCTAGGGTTCCCCCCCAGCCCGCATCTATCTCAGAGGCCAACGTCGTTGTAAATGCTCAACAAACGACA
AGTGAGAACCAATCGCGTCCTCCTTTGTCTCGTAAGCAAGAAAAAAAGGCGAAGAAGAAACTCGCCAGGGCGGAA
AAAGCGCAACGTGAAGCATTGGCGCAACTGGCTATATCATCTGGAGCTGCCAATACCGCGACAGCTACATCTTCA
TCTCAAATGCAAGTGAGCAATCACCTTCCGGTACGAGTTGATGCAAATGCTCAAGTCGTTAAATTGGGCGAATTA
CTACCTGTTGAAGATAATCCGGCAGGTTGGATGGCGCGTTTGCGGCGTTTCAAGGGTAATTATAAAATGCTCAAA
GATGCGACCGACGACAAAAGCCGTATAAATATTATCGGAGTAGTGAGGAGTGTTAAGCCCCCTCGTCTGTCAACC
AAAAGTGACTGGACTTCAAACGTTTATTTGCAAGACCCTAGTCTATTTCCGGATGGGGAGCAATATACTACGAAT
GACTATACCGTTAATTTCTTCCAGAGAAGGTTCAAGGAGTGGCTGCCACAAGTGAACATAGGAGATATCTTAGTT
TTGCGTGACATCAAGGTCCAAAATCACAGTGGTAACCTCTTTGGTGTTGGATATTACGACAGAGCCAAATGGGCT
GTCTATTCCATCAAAGACGAGTGCTTTGTCCCACCGAAACTAGACCAGGCCCCGAAAGAACAGGAGTTAGTAGAT
GGCGGCATCAAATTCACTCCATTTCTAAGCGCAAGTGAGCCGGAGGAGCGCTACTGCCAACAGTTGTCGGCTTGG
TGGAAAGAGAAGAACAAAGACTCAGCAGAATCGTCCGGTCATGTGTATAGCTTGAGTGAATCCACCATCCCCGGA
CGGACGCGGCGCCAGCATCTACTACTCTGCGATGCAGGACCGGATGTGGAACCTGGCGGATATTTCGACTGTACA
TTTGAGGTTGTTAATGCTTATCAGAGTAAGGATTACCCCCCTACTCTATATGTGACAGACTATACGAAAAATGCC
ATCGTTGCGCCTTGCCAGACGAAGTGGTGTCCACCTGGACTAAACGATTACATCGTGAAGTTTGAACTTTGGGAT
GCGGCAGTAAGCTTGGCCCCATCGCTTGTCCCTGGAACATATTGGACGGTTAGGAATGCTCGACTCAAGCGCGGC
CATGATGGATACGTTGAGGGGAAGATAGTCGAAAAGAAATTCTCTAAGCTTGAACCTGACTCCGAGTACGCTCCA
CTACAAGAATTGCTGAAACGCAAGAAGGAATGGGAAACCGCAAACAAACCAAGGCAAACGCGTTTTGAACACAAA
TTGCTCAAAGACGTCGGGGATGGAGATTACGCCAACTGCACCGTCGAGTTGTTGCATGCGTCCAAGGGTTATGAT
GAAGCTTATCTTGAGGTGACAGACTATACAGCCCATCCAAAGATGTCGTCCTATCGATATGAGAAGGACTGGTCC
CTGGATTTGGAAGGCCTTATTGTCAGTGTCCACCTACGTGATGCCCAGGTGCAACATGCAAAAACTTTACGTCCA
GGATTCTTCCTGAATATCAAAAACCTCCGACTGAAAGACAATCGTGTTCAAAAAAGGTTCCAGGGCGACTTGGGC
GGTCACGATGTTCTAGTTCATCGCCTCGATATCCATCATCCAAATGATGATCTCAAGGCGCTTTTGGAGCGTAAA
AAAGTTTGGCAGAAAATGAAAGATGCCAAGCTAGTAGCCCAGGAACAGCGGAAGTCAAGTGATAGAGTATTAGAT
CTCGCAAAACGACCCAATCTCACCATTAAAGAACTCAAGTCACATCCCAAAAAAATGCTCAAAGTCAGAGTGATC
GCACGTGTCGTTGCGTACCATCCAATTCCATCTGTATGGATTCACGCCTGGTGTTCGAAGTGCAAGCAAAGAATC
CCAGATGACAAGCGGGCATGCCATAATTGTCAAGACATGGACCACGAATTTGTTCGCTGGAAATTCAGGCTACTA
TTGCGGGTCGAAGACAGAAACGGGGATGCTATGGATGTTGTTCTGGGGGATCAGAGTGACTTCCTGCGAGGTTTT
GAGATAGGTGATTACTTCCATCATCCGTCCATCCTCTCAAGCATTTCAAAGCGGCTTGAACCTCTATTGGGCGAT
AGTAAAGTTGATCAGAGGGAAGAGACGGGAAAAGATCTTGACAATGATTACGTTGGGCTTATTATTGCACGTCAT
GAGAGCAGTAGAATTGAACCCATGTATATCCTATTTGATGTTGAGACTTGA
Gene >Agabi119p4|601400
ATGCTATTGGCGCGCACCAGTCGGCTCCTCGCCGACTTGCTGGCAGCAGGGATCTGGTGCACCTCGGTTTCTGCT
GGTTACTCATGGCCTTCACCGCAATACGAGGCATTGGAAACATTTTTATACGAAGGGAGGAGATACGACGGTTCG
AACTTGGCTTCGCTCCAACACCCATGCAAAAACAGGTCTGATACGGGCGCGTCAATTGGTGCTGAATGGCTGAGG
CTGGCATATCATGATGTTTCGACGCGAGATGCTGAAGCTGGGACGGGCGGGTTGGATGGATCAATTGCATACGAG
TTGGATAGAGAAGAAGTGAGTCAAATGGTCCAAGTAGCGTTGAGAATCATGGACTCTGAGCTTCATGTCCGAGTC
TAGAATGCGGGACAGGCGATGAGCGCTAGTTTGGCCGACTTTGAATCGTTCTCTAATAAATACGTATCTCGTGCG
TCTTCGAATGTTTACCTGTTCCCCTGTCACAGACTAACCTCATATATCCTTTCCAGGATCGGATGTCATCGCCGC
CGGTACAATATTCGCCGTTGCATCCTGCGGGGGTCCCATTATACCTTTTCGTGGCGGCCGTTTCGATGCAGTCAC
CGCAGCTTCAAGTTCTTTTAGTGTTCCAGAACCGTTCCAGGATTTTCAGACTCATCTAGACATGTTCCGCCGGCA
GGGATTTTCGCAGACGGAGATGATCACGTTGGTTGCTTGTGGACATACTATCGGTGGAGTGAGAAACACGGATTT
CCCTCATATTGTTTCCCCGAAAGGCGATTCAGAGAAACCTACCCTTGAAAACTTTGATCCTTCCCCGCAGTATGA
TAATCTAGTGTAAGTACCGACTACGTAACGCATTGGTGGACGTACGTTGATGAAGATATGATCAGGGTGCAGCAG
TATCTAGATGGCAGTACAAATAATCCGCTTGTTGTTCATCCGAACAAGACGATTACTTCGGACTTTCGAATATTC
TCAAGCGATAACAATGCGACTATGAAAAGGCAAGCTGCTTTCAAGTCTCAACTTTCGAGTAGCTGGCTGACATCT
ACTTCAGTTTGTCATCCCCTGATGCATATTTGAATTCATGTCGAACGGTTCTCGAGAAAATGCTCAACATGGTTC
CTTCGAATGTCGCGCTGACAGATGAAATACGGCTCTTGCAAGAGAAAGTTTTCAATGTTCAGTTGACACTTGAAC
ATGGGGAATTAGTTTTCAAGGCATCACTTCGGGTACGGGTTCCTGTAATCTTGAGCCTAGACTTGTTTTTACTCA
ACATGTTTGTATAGCTCGCTCAGTCTGTGGGCTCCAGTCCCAGTAAAGGCAGAGTTGTTCGAATGTTCTGGTGCA
ACCGCTACGGAGACGACAAGGATTGTTCTACCAACGCCAATGTTGTTTTTCAGGCAGCATCTACTCAGGACTCAC
CAGAAATTTCACCAATCACAGAACGACTAGGCTACTATTTCATCAACCATCAATTTGTTGTCAAAGTCGATCCTT
CAAAGTCGATTTCTCTTTTCTGGTTTGAGAGTGACGAACATGATGGTTCAACGCCAAAAATTATCGATAATGGAG
GGTCGGGGTATCAATTTGACCAAGACCGTATACTGTACGTCCCGATGTCTAGTCAGTTGGATATCACAGGTGGAG
ATGAAGCTTCCAAAGTCTATCAAATTGTCGCCGCAGTGAGTTAGTTTGCAAAAACCGTGACATTTTCGTTCATGA
CCCTTTATTTCATTTCCTAGGTTCGCAGCGACGTCTCACCTTCTCGAGTATATATGTCTGGTTTTGACAATGCCA
TACCCAAGCATGGACCCGCGATTACTATTGCCGAGGACCTCACACTAAATACAACCCTCAGTCCCGTAGAAGGCT
ATAATTTCTACTCTACCTCGATTCAATCTGCTGGGCTTCAGTTGACGGTCGATTTGCATGCTGACATTGATGGTA
ATACTTATACGGTTGATTTCCAACAGACGTATTTTTTAGGTTCAAGTCTTCCTTATACACCGCCGACTAATTCTA
ATATCACTGCTGTTGCTCAAATTCCTGGAGAATCTACTGATACTAACTCTGTACGATCTTTGCATCCTTCGTTTC
TAATATTTAGTTATCTCATACTCGTAACCTACATTGGACTTTTTGTATAACATGCTTCACAACTCGGACTTTCAG
TTACAACAATCTAGTAAATTCTTGATAGATTGCGAGAAGCGCGTTTAGGGGCCCAACTAAGGTAAGGGGGCGCGT
CCAAGTCGTCGCGTCATTAAGCGCACGTGCCAAGATCCAAACGCGTCAATCTTGCTTTAGAGCGCTCTTCGTCTC
TCCCAATGTCATGAAGCGACCACGCGATAACGAAGACGATACTACCAACAAGAGGCGGCGCAAGAATCTCGCGAG
TGATATCTTCGATGACGAATCTCTCAGCAATTGCCTCTGCAATGTTCAAGGGTTAAACAGTGCCATAGGATATTT
CACTGGCTCAGTGTCTATGAGATGGTCACCTGGTGGCAAGAAATTCATATTCCAGTTAACGTCTCGATGCTGCGT
TACACTTAGTCGAACTCACAAGATCAACGTTACTTTCGAGGGGGACTGGATTGAATCTATGCATGCTCGATGGGG
TCTTTTGTCTATCATGGAGAACATTCAACTATCGCTAGATGGAGTAACTTCCGTCTATCCGCAGACTTCGAAGCA
AACAGCGAAGCTGGTGTATACAGACGGTGTCATGTATCGAAAGATGCGAGAAGGGAAAGAAACGGAGGCATGCTT
CATCAATTCTTGGCAATGTAAGTCCACCCACTCTCGTTGAAGGAACATCGGGTGACTACATACACCTCAAATGTA
TAGTGCAAGAGGAACAAGACAAACAAGAGGATTTAGATTGGTTTGCTACGCCTACGGTACCTCTTAACGGATCTT
TATCGGAGTTTGTTCGTACGGCTTCTGCTGCTGGCCTCAAGAGTGTCCCCAGTCCAAAGGAAAACCAAACGTCTG
AAAAACATGATGATGACTCGAGTTTGTCGAAGGAGAACCTGCCTCCCGTCGACGAACATCCAACCAAACAACAAG
ATGTTGTCAGTACCGCAACTTCTAGGGTTCCCCCCCAGCCCGCATCTATCTCAGAGGCCAACGTCGTTGTAAATG
CTCAACAAACGACAAGTGAGAACCAATCGCGTCCTCCTTTGTCTCGTAAGCAAGAAAAAAAGGCGAAGAAGAAAC
TCGCCAGGGCGGAAAAAGCGCAACGTGAAGCATTGGCGCAACTGGCTATATCATCTGGAGCTGCCAATACCGCGA
CAGCTACATCTTCATCTCAAATGCAAGTGAGCAATCACCTTCCGGTACGAGTTGATGCAAATGCTCAAGTCGTTA
AATTGGGCGTAAGTACGGTCTCCCTTCACGCATATATTGACTATTAAATGGCCGAAAAGGAATTACTACCTGTTG
AAGATAATCCGGCAGGTTGGATGGCGCGTTTGCGGCGTTTCAAGGTACGTCCATCTTTTGAGGGTGCTGCTCGAC
ATAACAGTGATCTGATTGCAGGGTAATTATAAAATGCTCAAAGATGCGACCGACGACAAAAGCCGTATAAATATT
ATCGGAGTAGTGAGGAGTGTTAAGCCCCCTCGTCTGTCAACCAAAAGTGGTCAGTAAATTTCTTTCTCGCAATTG
CTCATTCCAATGTCCCTTCAGACTGGACTTCAAACGTTTATTTGCAAGACCCTAGTCTATTTCCGGATGGGGAGC
AATATACTACGAATGACTATACCGTTAATTTCTTCCAGAGAAGGTTCAAGGAGTGGCTGCCACAAGTGAACATAG
GAGATATCTTAGTTTTGCGTGACATCAAGGCAAGGTCACCGTCTTTGACTGACAATTTATCCACTTACTCGTACC
AAAGGTCCAAAATCACAGTGGTAACCTCTTTGGTGTTGGATATTACGACAGAGCCAAATGGGCTGTCTATTCCAT
CAAAGACGAGTGCTTTGTCCCACCGAAACTAGACCAGGCCCCGAAAGAACAGGAGTTAGTAGATGGCGGCATCAA
ATTCACTCCATTTCTAAGCGCAAGTGAGCCGGAGGAGCGCTACTGCCAACAGTTGTCGGCTTGGTGGAAAGAGAA
GAACAAAGACTCAGCAGAATCGTCCGGTCATGTGTATAGCTTGAGTGAATCCACCATCCCCGGACGGACGCGGCG
CCAGCATCTACTACTCTGCGATGCAGGACCGGATGTGGAACCTGGCGGATATTTCGACTGTACATTTGAGGTGAG
GTAGTCGTTTCGAATTTTCTTTCACTCAAAATCTTGACGATCTACAGGTTGTTAATGCTTATCAGAGTAAGGATT
ACCCCCCTACTCTATATGTGACAGACTATACGAAAAATGCCATCGTTGCGCCTTGCCAGACGAAGTGGTGTCCAC
CTGGACTAAACGATTACATCGTGAAGTTTGAACTTTGGGATGCGGCAGTAAGCTTGGCCCCATCGCTTGTCCCTG
GAACATATTGGACGGTTAGGAATGCTCGACTCAAGCGCGGCCATGATGGATACGTTGAGGGGAAGATAGTCGAAA
AGAAATTCTCTAAGCTTGAACCTGACTCCGAGTACGCTCCACTACAAGAATTGCTGAAGTGAGTTCATGGCTTTC
CTGTTATACCCGACTAATGCGGTTTCTGACCCAGACGCAAGAAGGAATGGGAAACCGCAAACAAACCAAGGCAAA
CGCGTTTTGAACACAAATTGCTCAAAGACGTCGGGGATGGAGATTACGCCAACTGCACCGTCGAGGTAAGCGATC
CCCATGTTGATATATTTCGGACTAAACGTTGGACAAGTTGTTGCATGCGTCCAAGGGTTATGATGAAGCTTATCT
TGAGGTGACAGACTATACAGCCCATCCAAAGATGTCGTCCTATCGATATGAGAAGGACTGGTCCCTGGATTTGGA
AGGCCTTATTGTCAGTGTCCACCTACGTGATGCCCAGGTGCAACATGCAAAAACTTTACGTCCAGGATTCTTCCT
GAATATCAAAAACCTCCGACTGAAAGACAATCGTGTTCAAAAAAGGTTCCAGGGCGACTTGGGCGGTCACGATGT
TCTAGTTCATCGCCTCGATATCCATCATCCAAATGATGATCTCAAGGCGCTTTTGGAGTGAGTGTTTCTGCCTCT
TTTGGAATTTTGGTTTTCAACATGCACAAGGCGTAAAAAAGTTTGGCAGAAAATGAAAGATGCCAAGCTAGTAGC
CCAGGAACAGCGGAAGTCAAGTGATAGAGTATTAGATCTCGCAAAACGACCCAATCTCACCATTAAAGAACTCAA
GTCACATCCCAAAAAAATGCTCAAAGTCAGAGTGATCGCACGTGTCGTTGCGTACCATCCAATTCCATCTGTATG
GATTCACGCCTGGTGTTCGAAGTGCAAGCAAAGGTGCCTAGACACCGCCACACGAATCAATGACTATGCTAAACA
CTGATTATTAAGAATCCCAGATGACAAGCGGGCATGCCATAATTGTCAAGACATGGACCACGAATTTGTTCGCTG
GAAATTCAGGCTACTATTGCGGGTCGAAGACAGAAACGGGGATGCTATGGATGTTGTTCTGGGGGATCAGGCAAG
TCGATCATCACGTTTCTCCGTACACAGATTTAATATACTATTTTTCAGAGTGACTTCCTGCGAGGTTTTGAGATA
GGTGATTACTTCCATCATCCGTCCATCCTCTCAAGCATTTCAAAGCGGCTTGAACCTCTATTGGGCGATAGTAAA
GTTGATCAGAGGGAAGAGACGGGAAAAGATCTTGACAATGATTACGTTGGGCTTATTATTGCACGTCATGAGAGC
AGTAGAATTGAACCCATGTATATCCTATTTGATGTTGAGACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail