Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|599450
Gene name
Locationscaffold_03a:447090..449381
Strand-
Gene length (bp)2291
Transcript length (bp)2046
Coding sequence length (bp)2046
Protein length (aa) 682

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20414 DUF6698 Family of unknown function (DUF6698) 2.5E-08 279 413

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 33 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|599450
MNHPAHSTQVTPSRPFLDASIVLLALLSAAFTTTMSSVSQSTTSTTSNSLDSLTNFGSTQASAYAQALLAGTNAL
QRCQIALDKKSEEVETLQAELSRLKVSMTASTTRKSRQRGAGDTVGTLLEHLKERITKDIRALAAMECLWLGDNS
FQQPPLLSNPFPSAPDRYASDENLDLYHTYILYTRLHVDYHGPLEGQSLLRKQVQQILSQERSTLVKNVRTAGKD
IFFGFPPIVSQAVCMKEYARAREPECLRFLVSPRQVPSVEIRPEDPMPPLKYLDLPPLLFPELDSTRAQEIFRCN
FLIQIARCILFGDKAPGRVLALQEGRIESNTVSSNCLARQRNITRTTPGLIATAAILACFVVSGDTVFSEKGAVT
GAAYRSRYLKFKLLLEESQEAGEPHTITTFKFWDQQLFAVENGQGEDFEFGSLDERDEDELSKHRRAVMLHTSPA
SMQASSTGSPTTVHSVSAARPNRTPQSAPTSTSGLPLHPPHTVSISSGQPTLQITPSPSPGVHSEIGERVFTPHL
SYMARSSAPIPASQPGSQVFQSLDNEDEGSDTEPDVDVTPVASVAPISRSESPIITLSATPSHRPSANDLVFVEV
PATQVMPVDEQQMASGSNDPNLATQPRNSRRGRPSKKGLNSAQPGPGPSTRELVQQSLGPDATAAPQMRSKLRSR
ANIGKH*
Coding >Agabi119p4|599450
ATGAATCATCCTGCCCACTCGACCCAGGTAACCCCGTCTAGGCCATTTTTGGACGCTTCCATTGTACTCCTCGCT
CTGTTGTCTGCCGCTTTTACTACCACAATGTCATCGGTTTCGCAATCTACAACTTCCACGACGTCAAACTCCCTC
GATTCGCTCACCAACTTCGGCAGCACTCAGGCGTCTGCTTATGCACAGGCTCTTCTTGCAGGTACTAATGCCCTT
CAACGTTGCCAGATTGCTCTCGACAAGAAGTCCGAGGAAGTGGAGACTCTGCAAGCCGAGCTGTCAAGATTGAAG
GTATCTATGACAGCGAGTACGACTCGGAAGAGCAGGCAACGCGGCGCTGGAGATACTGTGGGGACTTTGCTGGAA
CATCTGAAAGAACGGATTACTAAAGACATTCGGGCACTCGCGGCAATGGAATGCCTCTGGTTGGGTGACAACAGC
TTCCAACAGCCGCCCCTCTTGTCAAACCCCTTCCCTTCGGCTCCCGACCGCTATGCTTCAGACGAAAACCTTGAC
TTATACCATACGTATATTCTATATACGCGTCTTCATGTCGATTATCATGGGCCTCTCGAGGGTCAAAGTCTGCTC
AGAAAGCAGGTTCAACAAATTCTCTCTCAAGAACGATCTACCCTCGTCAAGAACGTTCGGACTGCTGGCAAAGAT
ATATTCTTCGGCTTCCCTCCAATCGTCTCCCAAGCGGTCTGTATGAAAGAATACGCTAGAGCACGCGAGCCCGAG
TGCCTCCGATTCCTTGTATCACCCCGCCAGGTTCCGTCTGTCGAAATTCGTCCGGAGGATCCAATGCCGCCCCTC
AAATATCTTGATTTACCCCCTCTTTTATTTCCCGAACTTGATAGCACTCGTGCGCAAGAGATTTTTCGCTGCAAT
TTTTTGATTCAGATTGCGCGATGCATTCTCTTCGGAGATAAGGCCCCCGGGCGTGTACTTGCACTACAAGAAGGA
CGAATCGAAAGCAACACCGTGTCTTCCAACTGCCTGGCTCGCCAGCGAAACATCACCAGAACTACGCCAGGCCTC
ATTGCCACTGCGGCCATCCTTGCATGCTTTGTCGTTTCGGGAGACACGGTGTTTTCGGAGAAGGGAGCGGTGACT
GGTGCGGCTTACAGGTCTCGATACCTCAAGTTTAAGCTTCTCCTCGAAGAGTCTCAAGAGGCCGGTGAACCCCAT
ACTATCACGACCTTCAAATTTTGGGATCAACAACTTTTCGCGGTCGAAAACGGACAGGGTGAAGACTTTGAATTT
GGCAGCCTGGATGAGAGAGATGAAGATGAGCTGTCGAAGCATCGTCGCGCGGTCATGCTTCATACGTCTCCTGCA
TCTATGCAGGCGAGCTCTACTGGCTCTCCCACCACTGTCCACTCAGTTTCTGCTGCTCGGCCCAACCGAACACCT
CAATCAGCCCCGACATCTACTTCAGGCCTGCCTCTGCACCCTCCCCACACTGTCTCCATCTCTTCTGGACAGCCT
ACTCTTCAGATCACGCCGTCTCCTTCCCCAGGTGTACACTCTGAAATCGGGGAGAGAGTTTTCACTCCTCATCTT
TCGTACATGGCCCGATCTTCAGCTCCCATCCCGGCGTCTCAGCCGGGATCACAAGTGTTTCAAAGTCTTGACAAC
GAAGATGAGGGTTCTGACACTGAACCTGATGTTGATGTCACTCCCGTTGCATCTGTAGCCCCGATCTCCCGGTCT
GAATCCCCTATTATCACTCTGTCTGCAACGCCGTCTCATCGTCCCTCCGCAAATGATCTTGTGTTCGTCGAAGTG
CCTGCCACTCAAGTTATGCCCGTTGATGAACAACAGATGGCATCTGGGTCCAATGACCCGAATCTCGCTACTCAG
CCCAGGAATTCACGTCGAGGCCGGCCATCGAAAAAAGGCCTTAACTCTGCACAGCCAGGGCCAGGGCCATCTACT
CGCGAATTAGTGCAACAGAGTTTGGGTCCTGATGCTACAGCTGCTCCTCAAATGAGGTCCAAGTTGCGTAGCAGG
GCCAATATAGGAAAACACTGA
Transcript >Agabi119p4|599450
ATGAATCATCCTGCCCACTCGACCCAGGTAACCCCGTCTAGGCCATTTTTGGACGCTTCCATTGTACTCCTCGCT
CTGTTGTCTGCCGCTTTTACTACCACAATGTCATCGGTTTCGCAATCTACAACTTCCACGACGTCAAACTCCCTC
GATTCGCTCACCAACTTCGGCAGCACTCAGGCGTCTGCTTATGCACAGGCTCTTCTTGCAGGTACTAATGCCCTT
CAACGTTGCCAGATTGCTCTCGACAAGAAGTCCGAGGAAGTGGAGACTCTGCAAGCCGAGCTGTCAAGATTGAAG
GTATCTATGACAGCGAGTACGACTCGGAAGAGCAGGCAACGCGGCGCTGGAGATACTGTGGGGACTTTGCTGGAA
CATCTGAAAGAACGGATTACTAAAGACATTCGGGCACTCGCGGCAATGGAATGCCTCTGGTTGGGTGACAACAGC
TTCCAACAGCCGCCCCTCTTGTCAAACCCCTTCCCTTCGGCTCCCGACCGCTATGCTTCAGACGAAAACCTTGAC
TTATACCATACGTATATTCTATATACGCGTCTTCATGTCGATTATCATGGGCCTCTCGAGGGTCAAAGTCTGCTC
AGAAAGCAGGTTCAACAAATTCTCTCTCAAGAACGATCTACCCTCGTCAAGAACGTTCGGACTGCTGGCAAAGAT
ATATTCTTCGGCTTCCCTCCAATCGTCTCCCAAGCGGTCTGTATGAAAGAATACGCTAGAGCACGCGAGCCCGAG
TGCCTCCGATTCCTTGTATCACCCCGCCAGGTTCCGTCTGTCGAAATTCGTCCGGAGGATCCAATGCCGCCCCTC
AAATATCTTGATTTACCCCCTCTTTTATTTCCCGAACTTGATAGCACTCGTGCGCAAGAGATTTTTCGCTGCAAT
TTTTTGATTCAGATTGCGCGATGCATTCTCTTCGGAGATAAGGCCCCCGGGCGTGTACTTGCACTACAAGAAGGA
CGAATCGAAAGCAACACCGTGTCTTCCAACTGCCTGGCTCGCCAGCGAAACATCACCAGAACTACGCCAGGCCTC
ATTGCCACTGCGGCCATCCTTGCATGCTTTGTCGTTTCGGGAGACACGGTGTTTTCGGAGAAGGGAGCGGTGACT
GGTGCGGCTTACAGGTCTCGATACCTCAAGTTTAAGCTTCTCCTCGAAGAGTCTCAAGAGGCCGGTGAACCCCAT
ACTATCACGACCTTCAAATTTTGGGATCAACAACTTTTCGCGGTCGAAAACGGACAGGGTGAAGACTTTGAATTT
GGCAGCCTGGATGAGAGAGATGAAGATGAGCTGTCGAAGCATCGTCGCGCGGTCATGCTTCATACGTCTCCTGCA
TCTATGCAGGCGAGCTCTACTGGCTCTCCCACCACTGTCCACTCAGTTTCTGCTGCTCGGCCCAACCGAACACCT
CAATCAGCCCCGACATCTACTTCAGGCCTGCCTCTGCACCCTCCCCACACTGTCTCCATCTCTTCTGGACAGCCT
ACTCTTCAGATCACGCCGTCTCCTTCCCCAGGTGTACACTCTGAAATCGGGGAGAGAGTTTTCACTCCTCATCTT
TCGTACATGGCCCGATCTTCAGCTCCCATCCCGGCGTCTCAGCCGGGATCACAAGTGTTTCAAAGTCTTGACAAC
GAAGATGAGGGTTCTGACACTGAACCTGATGTTGATGTCACTCCCGTTGCATCTGTAGCCCCGATCTCCCGGTCT
GAATCCCCTATTATCACTCTGTCTGCAACGCCGTCTCATCGTCCCTCCGCAAATGATCTTGTGTTCGTCGAAGTG
CCTGCCACTCAAGTTATGCCCGTTGATGAACAACAGATGGCATCTGGGTCCAATGACCCGAATCTCGCTACTCAG
CCCAGGAATTCACGTCGAGGCCGGCCATCGAAAAAAGGCCTTAACTCTGCACAGCCAGGGCCAGGGCCATCTACT
CGCGAATTAGTGCAACAGAGTTTGGGTCCTGATGCTACAGCTGCTCCTCAAATGAGGTCCAAGTTGCGTAGCAGG
GCCAATATAGGAAAACACTGA
Gene >Agabi119p4|599450
ATGAATCATCCTGCCCACTCGACCCAGGTAACCCCGTCTAGGCCATTTTTGGACGCTTCCATTGTACTCCTCGCT
CTGTTGTCTGCCGCTTTTACTACCACAATGTCATCGGTTTCGCAATCTACAACTTCCACGACGTCAAACTCCCTC
GATTCGCTCACCAACTTCGGCAGCACTCAGGCGTCTGCTTATGCACAGGCTCTTCTTGCAGGTACTAATGTCAAT
CCTGCAGCGTTCAAAGACGCAAGTTTTTCACTCTTATCTATTGTCGAAATACGTGCTTACTAGTTAGTTTATAGG
CCCTTCAACGTTGCCAGATTGCTCTCGACAAGAAGTCCGAGGAAGTGGAGACTCTGCAAGCCGAGCTGTCAAGAT
TGAAGGTATCTATGACAGCGAGTACGACTCGGAAGAGCAGGCAACGCGGCGCTGGAGATACTGTGGGGACTTTGC
TGGAACATCTGAAAGAACGGATTACTAAAGACATTCGGGCACTCGCGGCAATGGAATGCCTCTGGTTGGGTGACA
ACAGCTTCCAACAGCCGCCCCTCTTGTCAAACCCCTTCCCTTCGGCTCCCGACCGCTATGCTTCAGACGAAAACC
TTGACTTATACCATACGTATATTCTATATACGCGTCTTCATGTCGATTATCATGGGCCTCTCGAGGGTCAAAGTC
TGCTCAGAAAGCAGGTAAGTTCTAATATGTTCACAGTAGTACATTGATACGTATTGACTTTACTTTGGTTCAAGG
TTCAACAAATTCTCTCTCAAGAACGATCTACCCTCGTCAAGAACGTTCGGACTGCTGGCAAAGATATATTCTTCG
GCTTCCCTCCAATCGTCTCCCAAGCGGTCTGTATGAAAGAATACGCTAGAGCACGCGAGCCCGAGTGCCTCCGAT
TCCTTGTATCACCCCGCCAGGTTCCGTCTGTCGAAATTCGTCCGGAGGATCCAATGCCGCCCCTCAAATATCTTG
ATTTACCCCCTCTTTTATTTCCCGAACTTGATAGCACTCGTGCGCAAGAGATTTTTCGCTGCAATTTTTTGATTC
AGGTGGGTATTTTATCATTCAAATTTCATGTATCTTACCTTACTTCCTAACAGATTGCGCGATGCATTCTCTTCG
GAGATAAGGCCCCCGGGCGTGTACTTGCACTACAAGAAGGACGAATCGAAAGCAACACCGTGTCTTCCAACTGCC
TGGCTCGCCAGCGAAACATCACCAGAACTACGCCAGGCCTCATTGCCACTGCGGCCATCCTTGTACGTAGTTATC
TGCATTCTATCACTTGTGTCTAAACGATTCCTTCAATGTAGGCATGCTTTGTCGTTTCGGGAGACACGGTGTTTT
CGGAGAAGGGAGCGGTGACTGGTGCGGCTTACAGGTCTCGATACCTCAAGTTTAAGCTTCTCCTCGAAGAGTCTC
AAGAGGCCGGTGAACCCCATACTATCACGACCTTCAAATTTTGGGATCAACAACTTTTCGCGGTCGAAAACGGAC
AGGGTGAAGACTTTGAATTTGGCAGCCTGGATGAGAGAGATGAAGATGAGCTGTCGAAGCATCGTCGCGCGGTCA
TGCTTCATACGTCTCCTGCATCTATGCAGGCGAGCTCTACTGGCTCTCCCACCACTGTCCACTCAGTTTCTGCTG
CTCGGCCCAACCGAACACCTCAATCAGCCCCGACATCTACTTCAGGCCTGCCTCTGCACCCTCCCCACACTGTCT
CCATCTCTTCTGGACAGCCTACTCTTCAGATCACGCCGTCTCCTTCCCCAGGTGTACACTCTGAAATCGGGGAGA
GAGTTTTCACTCCTCATCTTTCGTACATGGCCCGATCTTCAGCTCCCATCCCGGCGTCTCAGCCGGGATCACAAG
TGTTTCAAAGTCTTGACAACGAAGATGAGGGTTCTGACACTGAACCTGATGTTGATGTCACTCCCGTTGCATCTG
TAGCCCCGATCTCCCGGTCTGAATCCCCTATTATCACTCTGTCTGCAACGCCGTCTCATCGTCCCTCCGCAAATG
ATCTTGTGTTCGTCGAAGTGCCTGCCACTCAAGTTATGCCCGTTGATGAACAACAGATGGCATCTGGGTCCAATG
ACCCGAATCTCGCTACTCAGCCCAGGAATTCACGTCGAGGCCGGCCATCGAAAAAAGGCCTTAACTCTGCACAGC
CAGGGCCAGGGCCATCTACTCGCGAATTAGTGCAACAGAGTTTGGGTCCTGATGCTACAGCTGCTCCTCAAATGA
GGTCCAAGTTGCGTAGCAGGGCCAATATAGGAAAACACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail