Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|598400
Gene name
Locationscaffold_03a:301596..302293
Strand-
Gene length (bp)697
Transcript length (bp)588
Coding sequence length (bp)588
Protein length (aa) 196

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01083 Cutinase Cutinase 1.7E-49 25 195

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q00298|CUTI_BOTFU Cutinase OS=Botryotinia fuckeliana GN=cutA PE=3 SV=1 24 183 2.0E-47
sp|Q8TGB8|CUTI_MONFR Cutinase OS=Monilinia fructicola GN=CUT1 PE=2 SV=1 24 191 4.0E-47
sp|Q9Y7G8|CUTI_PYRBR Cutinase OS=Pyrenopeziza brassicae PE=3 SV=1 22 183 5.0E-38
sp|B8NCM8|CUTI3_ASPFN Probable cutinase 1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=AFLA_039350 PE=3 SV=1 25 195 1.0E-29
sp|Q2U199|CUTI3_ASPOR Probable cutinase 3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090011000113 PE=3 SV=1 25 195 3.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q00298|CUTI_BOTFU Cutinase OS=Botryotinia fuckeliana GN=cutA PE=3 SV=1 24 183 2.0E-47
sp|Q8TGB8|CUTI_MONFR Cutinase OS=Monilinia fructicola GN=CUT1 PE=2 SV=1 24 191 4.0E-47
sp|Q9Y7G8|CUTI_PYRBR Cutinase OS=Pyrenopeziza brassicae PE=3 SV=1 22 183 5.0E-38
sp|B8NCM8|CUTI3_ASPFN Probable cutinase 1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=AFLA_039350 PE=3 SV=1 25 195 1.0E-29
sp|Q2U199|CUTI3_ASPOR Probable cutinase 3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090011000113 PE=3 SV=1 25 195 3.0E-29
sp|Q8X1P1|CUTI_BLUGH Cutinase OS=Blumeria graminis f. sp. hordei GN=CUT1 PE=3 SV=1 25 195 5.0E-29
sp|Q4X1N0|CUTI1_ASPFU Probable cutinase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G09380 PE=3 SV=1 2 195 1.0E-28
sp|B0XRY3|CUTI1_ASPFC Probable cutinase 1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_025250 PE=3 SV=1 2 195 1.0E-28
sp|A2R2W3|CUTI1_ASPNC Probable cutinase 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An14g02170 PE=3 SV=1 2 195 1.0E-28
sp|A1DGN0|CUTI1_NEOFI Probable cutinase 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_084890 PE=3 SV=1 2 195 4.0E-28
sp|Q5B2C1|CUTI1_EMENI Probable cutinase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN5309 PE=3 SV=1 20 195 5.0E-27
sp|A1C9G0|CUTI3_ASPCL Probable cutinase 3 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_055320 PE=3 SV=1 1 195 9.0E-26
sp|Q0CES4|CUTI2_ASPTN Probable cutinase 2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ATEG_07810 PE=3 SV=1 26 195 5.0E-25
sp|B6H2E9|CUTI2_PENRW Probable cutinase 2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=Pc13g05110 PE=3 SV=1 19 195 3.0E-24
sp|Q4W9Z4|CUTI3_ASPFU Probable cutinase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_4G03210 PE=3 SV=1 5 195 8.0E-24
sp|B0YEP5|CUTI3_ASPFC Probable cutinase 3 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_099910 PE=3 SV=1 5 195 8.0E-24
sp|Q5AX00|CUTI3_EMENI Cutinase 3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN7180 PE=2 SV=1 5 195 9.0E-24
sp|Q0CNE3|CUTI3_ASPTN Probable cutinase 3 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ATEG_04791 PE=3 SV=2 26 195 3.0E-23
sp|Q0CD01|CUTI1_ASPTN Probable cutinase 1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ATEG_08433 PE=3 SV=1 20 195 9.0E-23
sp|Q5AVY9|CUTI2_EMENI Cutinase 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN7541 PE=2 SV=2 26 195 2.0E-22
sp|A1D9W1|CUTI3_NEOFI Probable cutinase 3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_030250 PE=3 SV=1 26 195 3.0E-22
sp|A1CSZ4|CUTI1_ASPCL Probable cutinase 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_081180 PE=3 SV=1 20 195 2.0E-21
sp|P52956|CUTI1_ASPOR Cutinase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cutL PE=1 SV=1 7 195 2.0E-21
sp|B8MVS3|CUTI1_ASPFN Probable cutinase 1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=AFLA_072700 PE=3 SV=1 7 195 2.0E-21
sp|P63880|CUT1_MYCBO Probable cutinase Mb2006c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2006c PE=3 SV=1 9 195 2.0E-20
sp|P9WP43|CUT1_MYCTU Probable cutinase Rv1984c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1984c PE=1 SV=1 9 195 2.0E-20
sp|P9WP42|CUT1_MYCTO Probable cutinase MT2037 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2037 PE=3 SV=1 9 195 2.0E-20
sp|P41744|CUTI_ALTBR Cutinase OS=Alternaria brassicicola GN=CUTAB1 PE=2 SV=1 22 195 8.0E-20
sp|Q4WQV2|CUTI2_ASPFU Probable cutinase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_4G14120 PE=3 SV=1 25 195 1.0E-19
sp|B0Y537|CUTI2_ASPFC Probable cutinase 2 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_071270 PE=3 SV=1 25 195 1.0E-19
sp|A1CVT3|CUTI2_NEOFI Probable cutinase 2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_102190 PE=3 SV=1 25 195 1.0E-19
sp|Q0CW01|CUTI4_ASPTN Probable cutinase 4 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ATEG_02133 PE=3 SV=1 20 195 1.0E-19
sp|Q2TZY7|CUTI2_ASPOR Probable cutinase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090011000665 PE=3 SV=1 25 195 2.0E-19
sp|P11373|CUTI1_COLGL Cutinase 1 OS=Colletotrichum gloeosporioides GN=CUTA PE=1 SV=1 13 188 6.0E-19
sp|B8NBB2|CUTI2_ASPFN Probable cutinase 2 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=AFLA_044870 PE=3 SV=2 25 195 8.0E-19
sp|Q0CRP4|CUTI5_ASPTN Probable cutinase 5 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ATEG_03640 PE=3 SV=1 1 193 1.0E-18
sp|Q96US9|CUTI3_FUSSO Cutinase 3 OS=Fusarium solani subsp. pisi GN=CUT3 PE=3 SV=1 25 195 2.0E-18
sp|P10951|CUTI_COLCA Cutinase OS=Colletotrichum capsici GN=CUTA PE=1 SV=1 22 188 3.0E-18
sp|Q99174|CUTI_FUSSC Cutinase OS=Fusarium solani subsp. cucurbitae GN=CUTA PE=3 SV=1 25 195 4.0E-18
sp|Q96UT0|CUTI2_FUSSO Cutinase 2 OS=Fusarium solani subsp. pisi GN=CUT2 PE=3 SV=1 25 195 5.0E-18
sp|P00590|CUTI1_FUSSO Cutinase 1 OS=Fusarium solani subsp. pisi GN=CUT1 PE=1 SV=1 25 195 2.0E-17
sp|A5ABE6|CUTI2_ASPNC Probable cutinase 2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An11g00110 PE=3 SV=1 25 194 4.0E-17
sp|P9WP39|CUT3_MYCTU Probable cutinase cut3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cut3 PE=1 SV=1 1 195 2.0E-15
sp|P0A537|CUT3_MYCBO Probable cutinase cut3 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cut3 PE=3 SV=1 1 195 2.0E-15
sp|P9WP38|CUT3_MYCTO Probable cutinase cut3 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cut3 PE=3 SV=1 7 195 3.0E-15
sp|P30272|CUTI_MAGO7 Cutinase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CUT1 PE=3 SV=3 25 180 4.0E-15
sp|B6HLS9|CUTI1_PENRW Probable cutinase 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=Pc21g21220 PE=3 SV=1 26 195 2.0E-14
sp|P29292|CUTI_DIDRA Cutinase OS=Didymella rabiei GN=CUT PE=2 SV=1 22 195 7.0E-13
sp|P9WP41|CUT2_MYCTU Probable cutinase cut2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cut2 PE=1 SV=1 25 167 1.0E-09
sp|P9WP40|CUT2_MYCTO Probable cutinase cut2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cut2 PE=3 SV=1 25 167 1.0E-09
sp|P63882|CUT2_MYCBO Probable cutinase cut2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cut2 PE=3 SV=1 25 167 1.0E-09
sp|O59893|AXE2_TALPU Acetylxylan esterase 2 OS=Talaromyces purpurogenus GN=axe-2 PE=1 SV=1 1 142 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|598400
MFKASLLAVVLSTLAYAAPLDSRQSCADVTVVFARGTNAERPIGTTVGPPFRDALQSQLGGRSLNFVGVDYAATI
GGFLQGGDPEGARTMARDVTSFASSCPNTAIVMAGYSQGAQVTHLAANQISSSVQNRVNAVVVFGDPDNGDGFPG
VLNGRSITFCADGDNICDGGIIVLPPHFSYGQNVGEAASFVVSHL*
Coding >Agabi119p4|598400
ATGTTCAAAGCCAGCCTCCTCGCCGTTGTCCTCTCGACGCTCGCATACGCAGCTCCATTGGATTCTCGTCAGTCC
TGTGCTGACGTTACAGTTGTCTTCGCCAGAGGCACTAACGCTGAGCGACCTATTGGAACAACTGTTGGACCACCC
TTCCGGGATGCACTCCAATCACAACTCGGAGGAAGGTCTTTGAATTTCGTCGGTGTAGATTATGCTGCCACTATT
GGCGGCTTCTTGCAAGGCGGAGATCCAGAAGGCGCTCGTACCATGGCCAGAGATGTTACTTCGTTTGCAAGTTCG
TGCCCGAATACTGCTATCGTCATGGCTGGTTACAGTCAGGGGGCCCAAGTCACACACCTCGCCGCAAATCAAATT
TCTTCTTCCGTTCAGAATAGGGTGAATGCTGTCGTGGTTTTCGGTGATCCAGATAATGGTGACGGTTTCCCTGGC
GTGTTGAATGGTCGTTCGATCACTTTCTGCGCGGATGGTGACAATATTTGTGATGGGGGTATCATCGTCCTTCCA
CCTCATTTTAGCTATGGTCAGAATGTCGGAGAGGCCGCTAGTTTCGTGGTTTCCCATCTCTGA
Transcript >Agabi119p4|598400
ATGTTCAAAGCCAGCCTCCTCGCCGTTGTCCTCTCGACGCTCGCATACGCAGCTCCATTGGATTCTCGTCAGTCC
TGTGCTGACGTTACAGTTGTCTTCGCCAGAGGCACTAACGCTGAGCGACCTATTGGAACAACTGTTGGACCACCC
TTCCGGGATGCACTCCAATCACAACTCGGAGGAAGGTCTTTGAATTTCGTCGGTGTAGATTATGCTGCCACTATT
GGCGGCTTCTTGCAAGGCGGAGATCCAGAAGGCGCTCGTACCATGGCCAGAGATGTTACTTCGTTTGCAAGTTCG
TGCCCGAATACTGCTATCGTCATGGCTGGTTACAGTCAGGGGGCCCAAGTCACACACCTCGCCGCAAATCAAATT
TCTTCTTCCGTTCAGAATAGGGTGAATGCTGTCGTGGTTTTCGGTGATCCAGATAATGGTGACGGTTTCCCTGGC
GTGTTGAATGGTCGTTCGATCACTTTCTGCGCGGATGGTGACAATATTTGTGATGGGGGTATCATCGTCCTTCCA
CCTCATTTTAGCTATGGTCAGAATGTCGGAGAGGCCGCTAGTTTCGTGGTTTCCCATCTCTGA
Gene >Agabi119p4|598400
ATGTTCAAAGCCAGCCTCCTCGCCGTTGTCCTCTCGACGCTCGCATACGCAGCTCCATTGGATTCTCGTCAGTCC
TGTGCTGACGTTACAGTTGTCTTCGCCAGAGGCACTAACGCTGAGCGACCTATTGGAACAACTGTTGGACCACCC
TTCCGGGATGCACTCCAATCACAACTCGGAGGAAGGTCTTTGAATTTCGTCGGTGTAGATTATGCTGCCACTATT
GGCGGCTTCTTGCAAGGCGGAGATCCAGAAGGCGCTCGTACCATGGCCAGAGATGTTACTTCGTTTGCAAGTTCG
TGCCCGAATACTGCTATCGTCATGGCTGGTTACAGGTTTGTCATTAGTATCTCACTCCGAACTACCCTGATCAGG
TGGGGAATACAGTCAGGGGGCCCAAGTCACACACCTCGCCGCAAATCAAATTTCTTCTTCCGTTCAGAATAGGGT
GAATGCTGTCGTGGTTTTCGGTGATCCAGATAATGGTGACGGTTTCCCTGGCGTGTTGAATGGTCGTTCGATCAC
TTTCTGCGCGGATGGTGACAATATTTGTGATGGGGGTATCATCGTCCTTCCACCTCATTTTAGCTATGGTCAGGT
AAGGAATCGTTATGGGACATAATACCGACGCTCCGGTACTGACTTGTCCTATTAGAATGTCGGAGAGGCCGCTAG
TTTCGTGGTTTCCCATCTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail