Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|594800
Gene name
Locationscaffold_02:3215326..3216115
Strand+
Gene length (bp)789
Transcript length (bp)738
Coding sequence length (bp)738
Protein length (aa) 246

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00959 Phage_lysozyme Phage lysozyme 3.4E-15 111 225

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P11187|LYS_BPPH2 Lysozyme OS=Bacillus phage phi29 GN=15 PE=3 SV=1 84 235 3.0E-21
sp|P07540|LYS_BPPZA Lysozyme OS=Bacillus phage PZA GN=15 PE=3 SV=1 84 235 5.0E-21
sp|Q37896|LYS_BPB03 Lysozyme OS=Bacillus phage B103 GN=15 PE=3 SV=1 85 236 7.0E-19
sp|P62693|LYS_BPPHV Lysozyme OS=Lactococcus phage phivML3 GN=L3 PE=3 SV=1 84 231 4.0E-14
sp|P62692|LYS_BPLC2 Lysozyme OS=Lactococcus phage c2 GN=L3 PE=3 SV=1 84 231 4.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P11187|LYS_BPPH2 Lysozyme OS=Bacillus phage phi29 GN=15 PE=3 SV=1 84 235 3.0E-21
sp|P07540|LYS_BPPZA Lysozyme OS=Bacillus phage PZA GN=15 PE=3 SV=1 84 235 5.0E-21
sp|Q37896|LYS_BPB03 Lysozyme OS=Bacillus phage B103 GN=15 PE=3 SV=1 85 236 7.0E-19
sp|P62693|LYS_BPPHV Lysozyme OS=Lactococcus phage phivML3 GN=L3 PE=3 SV=1 84 231 4.0E-14
sp|P62692|LYS_BPLC2 Lysozyme OS=Lactococcus phage c2 GN=L3 PE=3 SV=1 84 231 4.0E-14
sp|O80292|LYS_BPPS1 Lysozyme OS=Bacteriophage PS119 GN=19 PE=3 SV=1 96 227 8.0E-14
sp|P78285|LYSD_ECOLI Lysozyme RrrD OS=Escherichia coli (strain K12) GN=rrrD PE=1 SV=1 96 227 3.0E-12
sp|P27359|LYS_BPP21 Lysozyme OS=Enterobacteria phage P21 GN=R PE=1 SV=1 96 230 7.0E-12
sp|O80288|LYS_BPPS3 Lysozyme OS=Bacteriophage PS34 GN=19 PE=3 SV=1 96 227 2.0E-11
sp|P10439|LYS_BPPA2 Lysozyme OS=Enterobacteria phage PA-2 GN=15 PE=3 SV=1 96 227 2.0E-11
sp|P09963|ENLYS_BPP22 Endolysin OS=Enterobacteria phage P22 GN=19 PE=1 SV=1 84 231 4.0E-09
sp|P51728|LYS_BPHC1 Lysozyme OS=Haemophilus phage HP1 (strain HP1c1) GN=lys PE=3 SV=1 84 230 9.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0009253 peptidoglycan catabolic process Yes
GO:0016998 cell wall macromolecule catabolic process Yes
GO:0003796 lysozyme activity Yes
GO:0016787 hydrolase activity No
GO:0044265 cellular macromolecule catabolic process No
GO:1901136 carbohydrate derivative catabolic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0061783 peptidoglycan muralytic activity No
GO:0009056 catabolic process No
GO:1901565 organonitrogen compound catabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0000270 peptidoglycan metabolic process No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:1901564 organonitrogen compound metabolic process No
GO:0009057 macromolecule catabolic process No
GO:0009987 cellular process No
GO:0006022 aminoglycan metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044248 cellular catabolic process No
GO:0003824 catalytic activity No
GO:0044036 cell wall macromolecule metabolic process No
GO:1901575 organic substance catabolic process No
GO:0044237 cellular metabolic process No
GO:0030203 glycosaminoglycan metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds No
GO:0008150 biological_process No
GO:0006026 aminoglycan catabolic process No
GO:0006027 glycosaminoglycan catabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|594800
MRTSFAYLFAIAVVSTTVGAAPNNVCHVDSTPGVCISTADCSKLGGTSHSSTDLCADSAGSECCVFVDADNDNEH
VARACAPPRVNSATISLIKEFEGFVKSPSPDPIGLPTVGFGHLCKSKGCAEVPYKFPLTEANAGKLLQTDIKSFT
KCVSDNIKDAVKLNANQFGALSSWAFNVGCGNVKASALVARLNRGEKPNTVAAEELPKWRLAGGKVLKGLVRRRA
AEVKLFKTASSAIAHPPKCG*
Coding >Agabi119p4|594800
ATGCGCACTTCTTTCGCCTACCTTTTTGCAATTGCCGTCGTGTCCACCACTGTCGGAGCGGCTCCCAACAATGTC
TGCCATGTCGACAGCACACCAGGTGTGTGTATTTCGACGGCAGACTGCTCCAAGCTCGGCGGAACGTCGCACTCA
TCGACAGACCTCTGCGCTGACTCTGCAGGATCAGAATGCTGTGTCTTCGTCGATGCCGACAACGACAACGAACAT
GTAGCTCGTGCTTGTGCCCCGCCACGGGTGAACAGCGCGACGATCTCATTGATCAAGGAGTTTGAGGGATTCGTC
AAGAGTCCATCTCCCGATCCAATAGGTCTTCCGACAGTGGGATTCGGCCACCTTTGCAAGTCTAAAGGGTGTGCC
GAAGTTCCCTACAAATTCCCACTCACCGAAGCGAACGCCGGGAAACTCCTCCAAACCGATATCAAGTCCTTCACG
AAATGTGTCTCGGATAACATCAAAGACGCAGTCAAGTTGAATGCGAATCAGTTCGGAGCACTCTCGTCTTGGGCC
TTTAATGTAGGCTGTGGAAACGTCAAGGCTTCAGCGCTGGTGGCGAGGTTGAACAGGGGCGAGAAGCCAAACACT
GTCGCTGCGGAGGAATTGCCCAAGTGGCGTTTGGCTGGTGGAAAAGTTTTGAAAGGGTTGGTAAGGAGACGGGCA
GCTGAAGTCAAGTTGTTCAAAACTGCTTCGAGCGCCATAGCCCATCCTCCCAAGTGCGGCTAG
Transcript >Agabi119p4|594800
ATGCGCACTTCTTTCGCCTACCTTTTTGCAATTGCCGTCGTGTCCACCACTGTCGGAGCGGCTCCCAACAATGTC
TGCCATGTCGACAGCACACCAGGTGTGTGTATTTCGACGGCAGACTGCTCCAAGCTCGGCGGAACGTCGCACTCA
TCGACAGACCTCTGCGCTGACTCTGCAGGATCAGAATGCTGTGTCTTCGTCGATGCCGACAACGACAACGAACAT
GTAGCTCGTGCTTGTGCCCCGCCACGGGTGAACAGCGCGACGATCTCATTGATCAAGGAGTTTGAGGGATTCGTC
AAGAGTCCATCTCCCGATCCAATAGGTCTTCCGACAGTGGGATTCGGCCACCTTTGCAAGTCTAAAGGGTGTGCC
GAAGTTCCCTACAAATTCCCACTCACCGAAGCGAACGCCGGGAAACTCCTCCAAACCGATATCAAGTCCTTCACG
AAATGTGTCTCGGATAACATCAAAGACGCAGTCAAGTTGAATGCGAATCAGTTCGGAGCACTCTCGTCTTGGGCC
TTTAATGTAGGCTGTGGAAACGTCAAGGCTTCAGCGCTGGTGGCGAGGTTGAACAGGGGCGAGAAGCCAAACACT
GTCGCTGCGGAGGAATTGCCCAAGTGGCGTTTGGCTGGTGGAAAAGTTTTGAAAGGGTTGGTAAGGAGACGGGCA
GCTGAAGTCAAGTTGTTCAAAACTGCTTCGAGCGCCATAGCCCATCCTCCCAAGTGCGGCTAG
Gene >Agabi119p4|594800
ATGCGCACTTCTTTCGCCTACCTTTTTGCAATTGCCGTCGTGTCCACCACTGTCGGAGCGGCTCCCAACAATGTC
TGCCATGTCGACAGCACACCAGGTGTGTGTATTTCGACGGCAGACTGCTCCAAGCTCGGCGGAACGTCGCACTCA
TCGACAGGTACGTTCTTTCGTTCTTCAAATAGAATGCAGTGATTGATTAATTTCTTAGACCTCTGCGCTGACTCT
GCAGGATCAGAATGCTGTGTCTTCGTCGATGCCGACAACGACAACGAACATGTAGCTCGTGCTTGTGCCCCGCCA
CGGGTGAACAGCGCGACGATCTCATTGATCAAGGAGTTTGAGGGATTCGTCAAGAGTCCATCTCCCGATCCAATA
GGTCTTCCGACAGTGGGATTCGGCCACCTTTGCAAGTCTAAAGGGTGTGCCGAAGTTCCCTACAAATTCCCACTC
ACCGAAGCGAACGCCGGGAAACTCCTCCAAACCGATATCAAGTCCTTCACGAAATGTGTCTCGGATAACATCAAA
GACGCAGTCAAGTTGAATGCGAATCAGTTCGGAGCACTCTCGTCTTGGGCCTTTAATGTAGGCTGTGGAAACGTC
AAGGCTTCAGCGCTGGTGGCGAGGTTGAACAGGGGCGAGAAGCCAAACACTGTCGCTGCGGAGGAATTGCCCAAG
TGGCGTTTGGCTGGTGGAAAAGTTTTGAAAGGGTTGGTAAGGAGACGGGCAGCTGAAGTCAAGTTGTTCAAAACT
GCTTCGAGCGCCATAGCCCATCCTCCCAAGTGCGGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail