Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|592850
Gene name
Locationscaffold_02:3017066..3019128
Strand-
Gene length (bp)2062
Transcript length (bp)1929
Coding sequence length (bp)1929
Protein length (aa) 643

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14223 Retrotran_gag_2 gag-polypeptide of LTR copia-type 1.6E-07 78 193

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|592850
MGPGWANIGTNSNALPKLSGAKNYDTWARRVKNALILIQHKDSTLTAWDVSGSSHPLPTLPTDSTELAKENAIRM
TLKLQATALIESTLPDHMIQEEFNSPRDLWGKMKLNYGVRGPTFVYERLQSLLNFKDQDTQDPSGQIAEFVATCS
QITATGATLHDSLQTMMLLSALPARMESTIGIILASAAKVSDLTIEKARATIAAAWRNPQNLAAARFKPSGQAPR
WQNATPGTSGQNQQQQQRPHGQQQQKPQGQQQRQQAPQGAKPDDDKKRKRTRGKGKGKGKGKAAAVEASPPDYTA
ASAIAFPTIAIPQGFEAQPYDPRSPSLSAPTTRSLVHRIRNEKAAITPPTPLIGELSHIKSQSSPDKIFVHSPLH
TEIIMLNIHDGNEWIDDRRHDVDYQNSIEPDLNYLESVDPSADGTWLDDGSREQSISIDCDQPFWALYGMPNDNI
ERTVPSNQSDDVKSITHNSSEPAARGWTTDNMGDEWNNQWLEPFSRPMDWNVEPAGSSTTSFRDTWDNTNRFPID
DTSFEIPSNLSWGELIERGYSIDDINVIPFPVWESPSDDHIPSGELSSNASVKLGSAIDHWLTDINNGYCDMFSD
NDELTHSPPSHYSFTWSFDLRHHYDLPFSLDDTIMENELPHG*
Coding >Agabi119p4|592850
ATGGGCCCCGGTTGGGCAAATATTGGTACCAACTCCAATGCTCTCCCCAAGCTCTCCGGCGCCAAGAACTATGAT
ACTTGGGCCCGTCGCGTCAAGAACGCCTTGATCCTTATCCAGCATAAGGACTCCACCCTGACCGCATGGGATGTT
AGCGGCAGTTCTCACCCGCTCCCCACTTTGCCTACCGACTCTACTGAGTTGGCAAAGGAGAATGCAATCAGGATG
ACTCTCAAATTGCAGGCAACTGCGTTGATCGAGTCTACCCTCCCGGACCACATGATCCAGGAGGAATTCAACAGC
CCAAGAGACCTCTGGGGTAAAATGAAGTTGAATTACGGAGTCCGAGGGCCGACTTTCGTCTATGAAAGGCTCCAG
TCCCTCCTAAACTTTAAGGATCAAGATACGCAGGATCCATCCGGACAGATTGCTGAATTCGTCGCAACCTGTTCG
CAAATCACTGCCACTGGGGCGACTCTTCACGACTCGCTCCAAACCATGATGCTCCTCTCCGCTCTTCCGGCTCGT
ATGGAATCTACGATCGGAATCATCCTCGCTTCGGCCGCAAAAGTGTCCGATCTCACCATTGAGAAAGCGAGAGCT
ACTATCGCCGCGGCTTGGCGAAACCCTCAGAATCTCGCCGCCGCCAGGTTTAAGCCGTCCGGACAGGCTCCGCGA
TGGCAGAATGCCACGCCTGGAACATCCGGGCAAAATCAGCAGCAGCAGCAGCGTCCTCATGGACAGCAGCAGCAA
AAGCCGCAAGGCCAGCAGCAAAGGCAACAAGCTCCGCAAGGAGCTAAACCTGACGATGATAAGAAGCGCAAGAGA
ACTCGTGGCAAAGGCAAGGGCAAGGGTAAAGGAAAAGCCGCAGCAGTTGAGGCCTCGCCTCCTGATTACACTGCA
GCTTCTGCGATCGCGTTCCCTACGATCGCCATTCCTCAGGGCTTTGAAGCCCAACCCTACGACCCTCGCTCACCT
TCTCTGTCTGCACCAACCACACGGTCTTTGGTGCATCGTATCCGAAATGAGAAAGCAGCTATCACGCCGCCGACT
CCCTTGATTGGTGAGTTGTCTCATATTAAATCGCAGTCATCTCCTGACAAAATTTTCGTGCACTCTCCCCTTCAC
ACGGAAATCATCATGTTGAATATCCATGATGGAAATGAATGGATTGATGATCGGCGTCACGACGTCGATTACCAA
AACTCGATCGAACCTGATCTGAACTATCTCGAATCGGTTGATCCATCTGCTGATGGAACCTGGCTCGATGATGGA
TCTCGGGAACAATCAATCTCGATTGATTGTGATCAACCCTTTTGGGCCTTATATGGTATGCCCAATGACAACATC
GAACGTACGGTTCCCTCGAACCAATCCGATGATGTCAAATCCATAACGCACAATTCTTCTGAACCTGCTGCACGT
GGATGGACAACCGATAATATGGGCGACGAATGGAACAACCAATGGCTGGAACCATTTTCCCGGCCTATGGATTGG
AACGTTGAACCTGCCGGTTCTTCCACCACTTCCTTTCGTGACACATGGGACAACACTAACCGCTTTCCCATCGAT
GATACGTCATTCGAAATCCCTTCAAACCTCTCCTGGGGTGAATTAATCGAACGGGGATATTCCATTGACGACATA
AATGTCATACCATTCCCTGTATGGGAATCGCCATCGGACGATCACATCCCCTCGGGTGAACTATCGTCCAATGCC
TCTGTTAAACTCGGATCTGCCATCGATCATTGGCTAACCGACATTAACAATGGATATTGTGACATGTTTTCGGAT
AACGACGAACTTACACATTCCCCTCCCTCGCACTATTCGTTCACATGGTCGTTTGACCTCCGTCATCACTACGAT
CTACCGTTCTCTTTGGACGATACGATCATGGAAAATGAACTTCCTCATGGATGA
Transcript >Agabi119p4|592850
ATGGGCCCCGGTTGGGCAAATATTGGTACCAACTCCAATGCTCTCCCCAAGCTCTCCGGCGCCAAGAACTATGAT
ACTTGGGCCCGTCGCGTCAAGAACGCCTTGATCCTTATCCAGCATAAGGACTCCACCCTGACCGCATGGGATGTT
AGCGGCAGTTCTCACCCGCTCCCCACTTTGCCTACCGACTCTACTGAGTTGGCAAAGGAGAATGCAATCAGGATG
ACTCTCAAATTGCAGGCAACTGCGTTGATCGAGTCTACCCTCCCGGACCACATGATCCAGGAGGAATTCAACAGC
CCAAGAGACCTCTGGGGTAAAATGAAGTTGAATTACGGAGTCCGAGGGCCGACTTTCGTCTATGAAAGGCTCCAG
TCCCTCCTAAACTTTAAGGATCAAGATACGCAGGATCCATCCGGACAGATTGCTGAATTCGTCGCAACCTGTTCG
CAAATCACTGCCACTGGGGCGACTCTTCACGACTCGCTCCAAACCATGATGCTCCTCTCCGCTCTTCCGGCTCGT
ATGGAATCTACGATCGGAATCATCCTCGCTTCGGCCGCAAAAGTGTCCGATCTCACCATTGAGAAAGCGAGAGCT
ACTATCGCCGCGGCTTGGCGAAACCCTCAGAATCTCGCCGCCGCCAGGTTTAAGCCGTCCGGACAGGCTCCGCGA
TGGCAGAATGCCACGCCTGGAACATCCGGGCAAAATCAGCAGCAGCAGCAGCGTCCTCATGGACAGCAGCAGCAA
AAGCCGCAAGGCCAGCAGCAAAGGCAACAAGCTCCGCAAGGAGCTAAACCTGACGATGATAAGAAGCGCAAGAGA
ACTCGTGGCAAAGGCAAGGGCAAGGGTAAAGGAAAAGCCGCAGCAGTTGAGGCCTCGCCTCCTGATTACACTGCA
GCTTCTGCGATCGCGTTCCCTACGATCGCCATTCCTCAGGGCTTTGAAGCCCAACCCTACGACCCTCGCTCACCT
TCTCTGTCTGCACCAACCACACGGTCTTTGGTGCATCGTATCCGAAATGAGAAAGCAGCTATCACGCCGCCGACT
CCCTTGATTGGTGAGTTGTCTCATATTAAATCGCAGTCATCTCCTGACAAAATTTTCGTGCACTCTCCCCTTCAC
ACGGAAATCATCATGTTGAATATCCATGATGGAAATGAATGGATTGATGATCGGCGTCACGACGTCGATTACCAA
AACTCGATCGAACCTGATCTGAACTATCTCGAATCGGTTGATCCATCTGCTGATGGAACCTGGCTCGATGATGGA
TCTCGGGAACAATCAATCTCGATTGATTGTGATCAACCCTTTTGGGCCTTATATGGTATGCCCAATGACAACATC
GAACGTACGGTTCCCTCGAACCAATCCGATGATGTCAAATCCATAACGCACAATTCTTCTGAACCTGCTGCACGT
GGATGGACAACCGATAATATGGGCGACGAATGGAACAACCAATGGCTGGAACCATTTTCCCGGCCTATGGATTGG
AACGTTGAACCTGCCGGTTCTTCCACCACTTCCTTTCGTGACACATGGGACAACACTAACCGCTTTCCCATCGAT
GATACGTCATTCGAAATCCCTTCAAACCTCTCCTGGGGTGAATTAATCGAACGGGGATATTCCATTGACGACATA
AATGTCATACCATTCCCTGTATGGGAATCGCCATCGGACGATCACATCCCCTCGGGTGAACTATCGTCCAATGCC
TCTGTTAAACTCGGATCTGCCATCGATCATTGGCTAACCGACATTAACAATGGATATTGTGACATGTTTTCGGAT
AACGACGAACTTACACATTCCCCTCCCTCGCACTATTCGTTCACATGGTCGTTTGACCTCCGTCATCACTACGAT
CTACCGTTCTCTTTGGACGATACGATCATGGAAAATGAACTTCCTCATGGATGA
Gene >Agabi119p4|592850
ATGGGCCCCGGTTGGTGCATCTATGGATGATCATTCGATCTCTAGACCAACCGCTTTTGGATGGATATTCTCTAG
CCCATTTAGAATAGCCTGTAGATAGCATGTCGTACCCTAGATCAGAGACTTACTGACCGATCCGGGTTGCAGGGC
AAATATTGGTACCAACTCCAATGCTCTCCCCAAGCTCTCCGGCGCCAAGAACTATGATACTTGGGCCCGTCGCGT
CAAGAACGCCTTGATCCTTATCCAGCATAAGGACTCCACCCTGACCGCATGGGATGTTAGCGGCAGTTCTCACCC
GCTCCCCACTTTGCCTACCGACTCTACTGAGTTGGCAAAGGAGAATGCAATCAGGATGACTCTCAAATTGCAGGC
AACTGCGTTGATCGAGTCTACCCTCCCGGACCACATGATCCAGGAGGAATTCAACAGCCCAAGAGACCTCTGGGG
TAAAATGAAGTTGAATTACGGAGTCCGAGGGCCGACTTTCGTCTATGAAAGGCTCCAGTCCCTCCTAAACTTTAA
GGATCAAGATACGCAGGATCCATCCGGACAGATTGCTGAATTCGTCGCAACCTGTTCGCAAATCACTGCCACTGG
GGCGACTCTTCACGACTCGCTCCAAACCATGATGCTCCTCTCCGCTCTTCCGGCTCGTATGGAATCTACGATCGG
AATCATCCTCGCTTCGGCCGCAAAAGTGTCCGATCTCACCATTGAGAAAGCGAGAGCTACTATCGCCGCGGCTTG
GCGAAACCCTCAGAATCTCGCCGCCGCCAGGTTTAAGCCGTCCGGACAGGCTCCGCGATGGCAGAATGCCACGCC
TGGAACATCCGGGCAAAATCAGCAGCAGCAGCAGCGTCCTCATGGACAGCAGCAGCAAAAGCCGCAAGGCCAGCA
GCAAAGGCAACAAGCTCCGCAAGGAGCTAAACCTGACGATGATAAGAAGCGCAAGAGAACTCGTGGCAAAGGCAA
GGGCAAGGGTAAAGGAAAAGCCGCAGCAGTTGAGGCCTCGCCTCCTGATTACACTGCAGCTTCTGCGATCGCGTT
CCCTACGATCGCCATTCCTCAGGGCTTTGAAGCCCAACCCTACGACCCTCGCTCACCTTCTCTGTCTGCACCAAC
CACACGGTCTTTGGTGCATCGTATCCGAAATGAGAAAGCAGCTATCACGCCGCCGACTCCCTTGATTGGTGAGTT
GTCTCATATTAAATCGCAGTCATCTCCTGACAAAATTTTCGTGCACTCTCCCCTTCACACGGAAATCATCATGTT
GAATATCCATGATGGAAATGAATGGATTGATGATCGGCGTCACGACGTCGATTACCAAAACTCGATCGAACCTGA
TCTGAACTATCTCGAATCGGTTGATCCATCTGCTGATGGAACCTGGCTCGATGATGGATCTCGGGAACAATCAAT
CTCGATTGATTGTGATCAACCCTTTTGGGCCTTATATGGTATGCCCAATGACAACATCGAACGTACGGTTCCCTC
GAACCAATCCGATGATGTCAAATCCATAACGCACAATTCTTCTGAACCTGCTGCACGTGGATGGACAACCGATAA
TATGGGCGACGAATGGAACAACCAATGGCTGGAACCATTTTCCCGGCCTATGGATTGGAACGTTGAACCTGCCGG
TTCTTCCACCACTTCCTTTCGTGACACATGGGACAACACTAACCGCTTTCCCATCGATGATACGTCATTCGAAAT
CCCTTCAAACCTCTCCTGGGGTGAATTAATCGAACGGGGATATTCCATTGACGACATAAATGTCATACCATTCCC
TGTATGGGAATCGCCATCGGACGATCACATCCCCTCGGGTGAACTATCGTCCAATGCCTCTGTTAAACTCGGATC
TGCCATCGATCATTGGCTAACCGACATTAACAATGGATATTGTGACATGTTTTCGGATAACGACGAACTTACACA
TTCCCCTCCCTCGCACTATTCGTTCACATGGTCGTTTGACCTCCGTCATCACTACGATCTACCGTTCTCTTTGGA
CGATACGATCATGGAAAATGAACTTCCTCATGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail