Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|590700
Gene name
Locationscaffold_02:2901514..2903733
Strand-
Gene length (bp)2219
Transcript length (bp)1626
Coding sequence length (bp)1626
Protein length (aa) 542

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13517 FG-GAP_3 FG-GAP-like repeat 1.2E-07 104 166

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8R4E1|TIP_RAT T-cell immunomodulatory protein OS=Rattus norvegicus GN=Itfg1 PE=2 SV=1 20 541 7.0E-42
sp|Q8TB96|TIP_HUMAN T-cell immunomodulatory protein OS=Homo sapiens GN=ITFG1 PE=1 SV=1 20 541 6.0E-40
sp|Q7RRM4|TIP_PLAYO T-cell immunomodulatory protein homolog OS=Plasmodium yoelii yoelii GN=PY00695 PE=3 SV=1 38 535 2.0E-39
sp|Q99KW9|TIP_MOUSE T-cell immunomodulatory protein OS=Mus musculus GN=Itfg1 PE=1 SV=2 20 541 2.0E-39
sp|Q8I3H7|TIP_PLAF7 T-cell immunomodulatory protein homolog OS=Plasmodium falciparum (isolate 3D7) GN=PFE1445c PE=3 SV=1 38 535 2.0E-36
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8R4E1|TIP_RAT T-cell immunomodulatory protein OS=Rattus norvegicus GN=Itfg1 PE=2 SV=1 20 541 7.0E-42
sp|Q8TB96|TIP_HUMAN T-cell immunomodulatory protein OS=Homo sapiens GN=ITFG1 PE=1 SV=1 20 541 6.0E-40
sp|Q7RRM4|TIP_PLAYO T-cell immunomodulatory protein homolog OS=Plasmodium yoelii yoelii GN=PY00695 PE=3 SV=1 38 535 2.0E-39
sp|Q99KW9|TIP_MOUSE T-cell immunomodulatory protein OS=Mus musculus GN=Itfg1 PE=1 SV=2 20 541 2.0E-39
sp|Q8I3H7|TIP_PLAF7 T-cell immunomodulatory protein homolog OS=Plasmodium falciparum (isolate 3D7) GN=PFE1445c PE=3 SV=1 38 535 2.0E-36
sp|Q95KC8|TIP_MACFA T-cell immunomodulatory protein (Fragment) OS=Macaca fascicularis GN=ITFG1 PE=2 SV=2 243 541 3.0E-33
sp|P30639|LNKN1_CAEEL Protein linkin OS=Caenorhabditis elegans GN=lnkn-1 PE=2 SV=1 28 541 2.0E-19
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.45

Transmembrane Domains

Domain # Start End Length
1 495 517 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|590700
MGQETNSKEIDMYLYQSIPNKGFDTANPIHVQTSISSQPIPLDVNGDLRIDLLGLTPDGGSKLQVWKNVWNSSRT
DSPLFDVQSSYFNDSHCQIANPHSNAVVDLNGDCLADVFLVCDEGRGQKSFQIWLNKKSQSFVLAMQGSLPSGTQ
SISFADIDRDGPMDMIFTTCKVVSSSGVGSDCYINIAYNQQLRFMFLHDRLWHEEWCTNSPDNNAFVRFPVSSLF
RDGHKQSLLVWDTSFDPPIPLSLRLGDANLDGFPDFLAIFASGNDRTPYLPYSKHCASGVAGCDSKVRGGRGWEV
ATNSGMKALANGTLDILVQRTGLQDGSKVLFIQNNFYYDAFFLKAIALNGACDSGWCYSANGSERYHPFGVRYSG
ATYKYTVFDTLGHRSAAESKFVFVTSYPLLPLTHVEPIVGQLPQTSYHALQTPYSFFGLGRTNNYIENMFVGTTL
HAPEHYINMEGSVIPNSRVVILPPADGGESGGTWKRELFLRSGDWIPWVTVTCVIGMVILAIIVFVLHLNEKRED
ELERRRISHHINFDAL*
Coding >Agabi119p4|590700
ATGGGTCAAGAAACAAATTCGAAAGAGATTGACATGTATCTCTATCAATCAATACCGAATAAAGGTTTTGATACT
GCGAACCCAATACATGTTCAAACATCAATTTCGTCGCAACCTATACCCCTGGATGTCAATGGAGATCTCAGAATT
GATCTCTTAGGTCTGACACCTGATGGAGGAAGCAAGCTTCAGGTTTGGAAAAATGTCTGGAATTCATCGAGGACT
GATTCACCGCTCTTTGATGTGCAATCATCATACTTCAACGACTCCCATTGTCAAATTGCGAACCCTCATAGTAAT
GCCGTCGTAGACCTTAATGGTGATTGCTTGGCTGATGTCTTCCTTGTTTGTGATGAGGGCCGCGGACAGAAATCG
TTTCAGATCTGGCTCAACAAAAAGTCTCAAAGTTTTGTTCTGGCTATGCAAGGAAGCTTACCATCTGGTACACAA
AGTATCTCCTTTGCCGATATCGACAGAGATGGGCCGATGGACATGATATTCACGACATGTAAAGTGGTCTCTTCG
AGTGGAGTCGGTTCAGACTGTTACATTAACATTGCATATAACCAACAACTTCGTTTTATGTTCCTACACGACCGA
CTCTGGCATGAAGAATGGTGTACGAACAGCCCTGACAACAATGCTTTTGTTCGCTTTCCTGTTTCATCCCTTTTC
CGTGATGGTCACAAGCAATCCCTGCTTGTTTGGGATACGAGCTTTGATCCACCCATTCCCCTTTCATTACGCTTA
GGCGATGCCAATTTGGACGGCTTTCCCGATTTCCTGGCCATCTTTGCCTCAGGCAATGATCGGACACCGTATCTC
CCCTATTCCAAGCATTGTGCTTCTGGAGTTGCAGGGTGTGACAGTAAAGTTCGGGGGGGAAGAGGATGGGAGGTT
GCTACGAATTCCGGGATGAAGGCTCTAGCAAATGGTACACTTGACATCTTGGTGCAGCGGACTGGATTGCAGGAT
GGGAGCAAGGTTTTGTTTATTCAGAATAACTTTTACTATGATGCCTTTTTCTTAAAGGCAATCGCGCTCAATGGT
GCCTGTGATAGCGGATGGTGTTATTCTGCTAATGGGTCTGAACGCTACCATCCCTTCGGTGTCAGATATTCAGGA
GCAACGTACAAGTATACAGTATTCGATACATTAGGACATCGTTCAGCGGCTGAGTCAAAGTTTGTCTTTGTCACC
TCTTATCCTCTCTTGCCGCTAACACATGTTGAACCAATAGTTGGCCAACTTCCTCAAACGTCCTACCACGCGCTT
CAAACACCCTACTCATTTTTCGGCCTTGGTCGAACAAACAACTACATCGAGAATATGTTTGTCGGTACAACACTG
CATGCACCCGAACATTATATCAACATGGAAGGCAGTGTAATACCCAATTCTCGAGTCGTCATTCTACCACCTGCG
GATGGTGGTGAAAGTGGTGGAACATGGAAGCGAGAATTATTTTTGCGGTCTGGTGATTGGATTCCATGGGTGACT
GTTACTTGTGTTATTGGGATGGTAATTCTGGCCATAATTGTGTTTGTTTTGCATTTGAATGAGAAGAGAGAAGAT
GAGTTGGAGCGGAGGCGGATATCACATCATATCAATTTCGATGCTCTCTAA
Transcript >Agabi119p4|590700
ATGGGTCAAGAAACAAATTCGAAAGAGATTGACATGTATCTCTATCAATCAATACCGAATAAAGGTTTTGATACT
GCGAACCCAATACATGTTCAAACATCAATTTCGTCGCAACCTATACCCCTGGATGTCAATGGAGATCTCAGAATT
GATCTCTTAGGTCTGACACCTGATGGAGGAAGCAAGCTTCAGGTTTGGAAAAATGTCTGGAATTCATCGAGGACT
GATTCACCGCTCTTTGATGTGCAATCATCATACTTCAACGACTCCCATTGTCAAATTGCGAACCCTCATAGTAAT
GCCGTCGTAGACCTTAATGGTGATTGCTTGGCTGATGTCTTCCTTGTTTGTGATGAGGGCCGCGGACAGAAATCG
TTTCAGATCTGGCTCAACAAAAAGTCTCAAAGTTTTGTTCTGGCTATGCAAGGAAGCTTACCATCTGGTACACAA
AGTATCTCCTTTGCCGATATCGACAGAGATGGGCCGATGGACATGATATTCACGACATGTAAAGTGGTCTCTTCG
AGTGGAGTCGGTTCAGACTGTTACATTAACATTGCATATAACCAACAACTTCGTTTTATGTTCCTACACGACCGA
CTCTGGCATGAAGAATGGTGTACGAACAGCCCTGACAACAATGCTTTTGTTCGCTTTCCTGTTTCATCCCTTTTC
CGTGATGGTCACAAGCAATCCCTGCTTGTTTGGGATACGAGCTTTGATCCACCCATTCCCCTTTCATTACGCTTA
GGCGATGCCAATTTGGACGGCTTTCCCGATTTCCTGGCCATCTTTGCCTCAGGCAATGATCGGACACCGTATCTC
CCCTATTCCAAGCATTGTGCTTCTGGAGTTGCAGGGTGTGACAGTAAAGTTCGGGGGGGAAGAGGATGGGAGGTT
GCTACGAATTCCGGGATGAAGGCTCTAGCAAATGGTACACTTGACATCTTGGTGCAGCGGACTGGATTGCAGGAT
GGGAGCAAGGTTTTGTTTATTCAGAATAACTTTTACTATGATGCCTTTTTCTTAAAGGCAATCGCGCTCAATGGT
GCCTGTGATAGCGGATGGTGTTATTCTGCTAATGGGTCTGAACGCTACCATCCCTTCGGTGTCAGATATTCAGGA
GCAACGTACAAGTATACAGTATTCGATACATTAGGACATCGTTCAGCGGCTGAGTCAAAGTTTGTCTTTGTCACC
TCTTATCCTCTCTTGCCGCTAACACATGTTGAACCAATAGTTGGCCAACTTCCTCAAACGTCCTACCACGCGCTT
CAAACACCCTACTCATTTTTCGGCCTTGGTCGAACAAACAACTACATCGAGAATATGTTTGTCGGTACAACACTG
CATGCACCCGAACATTATATCAACATGGAAGGCAGTGTAATACCCAATTCTCGAGTCGTCATTCTACCACCTGCG
GATGGTGGTGAAAGTGGTGGAACATGGAAGCGAGAATTATTTTTGCGGTCTGGTGATTGGATTCCATGGGTGACT
GTTACTTGTGTTATTGGGATGGTAATTCTGGCCATAATTGTGTTTGTTTTGCATTTGAATGAGAAGAGAGAAGAT
GAGTTGGAGCGGAGGCGGATATCACATCATATCAATTTCGATGCTCTCTAA
Gene >Agabi119p4|590700
ATGGGTCAAGAAACAAATTCGAAAGAGATTGACATGTATCTCTATCAATCAATACCGAATAAAGGTTTTGGTACG
TTGCTGAATCATGCATATTTTACGACAACCTTGTTAAACGCGTCAATTAAAGATACTGCGAACCCAATACATGTT
CAAACATCAATTTCGTCGCAACCTATACCCCTGGATGTCAATGGAGATCTCAGAATTGATCTCTTAGGTCTGACA
CCTGATGGAGGAAGCAAGCTTCAGGTTTGGAAAAATGTCTGGAATTCATCGAGGACTGATTCACCGCTCTTTGAT
GTGTGAGTATTTCAAATTGGTTTCTCAATACCATTCACAAATGTCACGTAGGCAATCATCATACTTCAACGACTC
CCATTGTCAAATTGCGAACCCTCATAGTAATGCCGTCGTAGACCTTAATGGTGATTGCTTGGCTGGTGTGTACTC
ATGCGCAGGATGTGATATACTGGCTGTAACCAACGCGTGTTAGATGTCTTCCTTGTTTGTGATGAGGGCCGCGGA
CAGAAATCGTTTCAGATCTGGCTCAACAAAAAGTCTCAAAGTTTTGTTCTGGCTATGCAAGGAAGCTTACCATCT
GGTACACAAAGTATCTCCTTTGCCGATATCGGTAAACTCAAACATCGATTTGTTTCATAGATTGTCCACTGACAG
CTACACAGACAGAGATGGGCCGATGGACATGATATTCACGACATGTAAAGTGGTCTCTTCGAGTGGAGTCGGTTC
AGACTGTTACATTAACATTGCATATAACCAACAACTTCGTTTTATGTTCCTACACGACCGACTCTGGCATGAAGA
ATGGTGTACGAGTGTGTAGACCACCGAACGATCTTTGTACCGCCGATGACAACTTTCAATTCAATCTTCTAGACA
GCCCTGACAACAATGTCAGTTCCCGACTTCAATGTCCTTTCTACGCACTTATTTCAGTTATATAGGCTTTTGTTC
GCTTTCCTGTTTCATCCCTTTTCCGTGATGGTCACAAGCAATCCCTGCTTGTTTGGGATACGAGCTTTGATCCAC
CCATTCCCCTTTCATTACGCTTAGGCGATGCCAATTTGGACGGCTTTCCCGATTTCCTGGCCATCTTTGCCTCAG
GCAATGATCGGACACCGTATCTCCCCTATTCCAAGCATTGTGCTTCTGGAGTTGCAGGGTGTGACAGTAAAGTTC
GGGGGGGAAGAGGATGGGAGGTTGCTACGAATTCCGGGATGAAGGCTCTAGCAAATGTAAAAGACGCAAGGGGTG
TGGCATTTTTGGATATGGATGAAGATTTGAGTGATCTTCTATAAACAATTTTCTGCACGATGACAAGAGACTCAA
TGATATGTACAGGGTACACTTGACATCTTGGTGCAGCGGACTGGATTGCAGGATGGGAGCAAGGTTTTGTTTATT
CAGAATAACTTTTACTATGATGCCTTTTTCTTAAAGGCAATCGGTGCGTTTCTCTATGAGCCGGGTCTACGAAAA
GCTGATGAATCAATCAATATCTTTCCAGCGCTCAATGGTGCCTGTGATAGCGGATGGTGTTATTCTGCTAATGGG
TCTGAACGCTACCATGTAAAACCTTGCCATTGACTGATAGTCGAGTCCGTACTGATGGTTCATCGTAGCCCTTCG
GTGTCAGATATTCAGGAGCAACGTACAAGTATACAGTATTCGATACATTAGGACATCGTTCAGCGGCTGAGTCAA
AGTTTGTCTTTGTCACCTCTTATCCTCTCTTGCCGCTAACACATGTTGAACCAATAGTTGGCCAACTTCCTCAAA
CGTCCTACCACGCGCTTCAAACACCCTACTCATTTTTCGGCCTTGGTCGAACAAACAACTACATCGAGAATATGT
TTGTCGGTACAACACTGCATGCACCCGAACATTATATCAACATGGAAGGCAGTGTAATACCCAATTCTCGAGTCG
TCATTCTACCACCTGCGGATGGTGGTGAAAGTGGTGGAACATGGAAGCGAGAATTATTTTTGCGGTCTGGTGATT
GGATTCCATGGGTGACTGTTACTTGTGTTATTGGGATGGTAATTCTGGCCATAATTGTGTTTGTTTTGCATTTGA
ATGAGAAGGTGAGTTCGCGATTTTTTATAACGTGCTAAGAGGTAATTGTGGTGTGGAAGAGAGAAGATGAGTTGG
AGCGGAGGCGGATATCACATCATATCAATTTCGATGCTCTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail