Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|590700
Gene name
Locationscaffold_02:2901514..2903733
Strand-
Gene length (bp)2219
Transcript length (bp)1626
Coding sequence length (bp)1626
Protein length (aa) 542

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13517 FG-GAP_3 FG-GAP-like repeat 1.2E-07 104 166

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8R4E1|TIP_RAT T-cell immunomodulatory protein OS=Rattus norvegicus GN=Itfg1 PE=2 SV=1 20 541 7.0E-42
sp|Q8TB96|TIP_HUMAN T-cell immunomodulatory protein OS=Homo sapiens GN=ITFG1 PE=1 SV=1 20 541 6.0E-40
sp|Q7RRM4|TIP_PLAYO T-cell immunomodulatory protein homolog OS=Plasmodium yoelii yoelii GN=PY00695 PE=3 SV=1 38 535 2.0E-39
sp|Q99KW9|TIP_MOUSE T-cell immunomodulatory protein OS=Mus musculus GN=Itfg1 PE=1 SV=2 20 541 2.0E-39
sp|Q8I3H7|TIP_PLAF7 T-cell immunomodulatory protein homolog OS=Plasmodium falciparum (isolate 3D7) GN=PFE1445c PE=3 SV=1 38 535 2.0E-36
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8R4E1|TIP_RAT T-cell immunomodulatory protein OS=Rattus norvegicus GN=Itfg1 PE=2 SV=1 20 541 7.0E-42
sp|Q8TB96|TIP_HUMAN T-cell immunomodulatory protein OS=Homo sapiens GN=ITFG1 PE=1 SV=1 20 541 6.0E-40
sp|Q7RRM4|TIP_PLAYO T-cell immunomodulatory protein homolog OS=Plasmodium yoelii yoelii GN=PY00695 PE=3 SV=1 38 535 2.0E-39
sp|Q99KW9|TIP_MOUSE T-cell immunomodulatory protein OS=Mus musculus GN=Itfg1 PE=1 SV=2 20 541 2.0E-39
sp|Q8I3H7|TIP_PLAF7 T-cell immunomodulatory protein homolog OS=Plasmodium falciparum (isolate 3D7) GN=PFE1445c PE=3 SV=1 38 535 2.0E-36
sp|Q95KC8|TIP_MACFA T-cell immunomodulatory protein (Fragment) OS=Macaca fascicularis GN=ITFG1 PE=2 SV=2 243 541 3.0E-33
sp|P30639|LNKN1_CAEEL Protein linkin OS=Caenorhabditis elegans GN=lnkn-1 PE=2 SV=1 28 541 2.0E-19
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 495 517 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID5
Orthogroup417
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|062860
Agaricus bisporus var bisporus H39 AgabiH39|270400
Agaricus bisporus var bisporus H97 AgabiH97|062860
Agaricus bisporus var burnettii H119p4 Agabi119p4|062860
Agaricus bisporus var burnettii H119p4 Agabi119p4|590700 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|590700
MGQETNSKEIDMYLYQSIPNKGFDTANPIHVQTSISSQPIPLDVNGDLRIDLLGLTPDGGSKLQVWKNVWNSSRT
DSPLFDVQSSYFNDSHCQIANPHSNAVVDLNGDCLADVFLVCDEGRGQKSFQIWLNKKSQSFVLAMQGSLPSGTQ
SISFADIDRDGPMDMIFTTCKVVSSSGVGSDCYINIAYNQQLRFMFLHDRLWHEEWCTNSPDNNAFVRFPVSSLF
RDGHKQSLLVWDTSFDPPIPLSLRLGDANLDGFPDFLAIFASGNDRTPYLPYSKHCASGVAGCDSKVRGGRGWEV
ATNSGMKALANGTLDILVQRTGLQDGSKVLFIQNNFYYDAFFLKAIALNGACDSGWCYSANGSERYHPFGVRYSG
ATYKYTVFDTLGHRSAAESKFVFVTSYPLLPLTHVEPIVGQLPQTSYHALQTPYSFFGLGRTNNYIENMFVGTTL
HAPEHYINMEGSVIPNSRVVILPPADGGESGGTWKRELFLRSGDWIPWVTVTCVIGMVILAIIVFVLHLNEKRED
ELERRRISHHINFDAL*
Coding >Agabi119p4|590700
ATGGGTCAAGAAACAAATTCGAAAGAGATTGACATGTATCTCTATCAATCAATACCGAATAAAGGTTTTGATACT
GCGAACCCAATACATGTTCAAACATCAATTTCGTCGCAACCTATACCCCTGGATGTCAATGGAGATCTCAGAATT
GATCTCTTAGGTCTGACACCTGATGGAGGAAGCAAGCTTCAGGTTTGGAAAAATGTCTGGAATTCATCGAGGACT
GATTCACCGCTCTTTGATGTGCAATCATCATACTTCAACGACTCCCATTGTCAAATTGCGAACCCTCATAGTAAT
GCCGTCGTAGACCTTAATGGTGATTGCTTGGCTGATGTCTTCCTTGTTTGTGATGAGGGCCGCGGACAGAAATCG
TTTCAGATCTGGCTCAACAAAAAGTCTCAAAGTTTTGTTCTGGCTATGCAAGGAAGCTTACCATCTGGTACACAA
AGTATCTCCTTTGCCGATATCGACAGAGATGGGCCGATGGACATGATATTCACGACATGTAAAGTGGTCTCTTCG
AGTGGAGTCGGTTCAGACTGTTACATTAACATTGCATATAACCAACAACTTCGTTTTATGTTCCTACACGACCGA
CTCTGGCATGAAGAATGGTGTACGAACAGCCCTGACAACAATGCTTTTGTTCGCTTTCCTGTTTCATCCCTTTTC
CGTGATGGTCACAAGCAATCCCTGCTTGTTTGGGATACGAGCTTTGATCCACCCATTCCCCTTTCATTACGCTTA
GGCGATGCCAATTTGGACGGCTTTCCCGATTTCCTGGCCATCTTTGCCTCAGGCAATGATCGGACACCGTATCTC
CCCTATTCCAAGCATTGTGCTTCTGGAGTTGCAGGGTGTGACAGTAAAGTTCGGGGGGGAAGAGGATGGGAGGTT
GCTACGAATTCCGGGATGAAGGCTCTAGCAAATGGTACACTTGACATCTTGGTGCAGCGGACTGGATTGCAGGAT
GGGAGCAAGGTTTTGTTTATTCAGAATAACTTTTACTATGATGCCTTTTTCTTAAAGGCAATCGCGCTCAATGGT
GCCTGTGATAGCGGATGGTGTTATTCTGCTAATGGGTCTGAACGCTACCATCCCTTCGGTGTCAGATATTCAGGA
GCAACGTACAAGTATACAGTATTCGATACATTAGGACATCGTTCAGCGGCTGAGTCAAAGTTTGTCTTTGTCACC
TCTTATCCTCTCTTGCCGCTAACACATGTTGAACCAATAGTTGGCCAACTTCCTCAAACGTCCTACCACGCGCTT
CAAACACCCTACTCATTTTTCGGCCTTGGTCGAACAAACAACTACATCGAGAATATGTTTGTCGGTACAACACTG
CATGCACCCGAACATTATATCAACATGGAAGGCAGTGTAATACCCAATTCTCGAGTCGTCATTCTACCACCTGCG
GATGGTGGTGAAAGTGGTGGAACATGGAAGCGAGAATTATTTTTGCGGTCTGGTGATTGGATTCCATGGGTGACT
GTTACTTGTGTTATTGGGATGGTAATTCTGGCCATAATTGTGTTTGTTTTGCATTTGAATGAGAAGAGAGAAGAT
GAGTTGGAGCGGAGGCGGATATCACATCATATCAATTTCGATGCTCTCTAA
Transcript >Agabi119p4|590700
ATGGGTCAAGAAACAAATTCGAAAGAGATTGACATGTATCTCTATCAATCAATACCGAATAAAGGTTTTGATACT
GCGAACCCAATACATGTTCAAACATCAATTTCGTCGCAACCTATACCCCTGGATGTCAATGGAGATCTCAGAATT
GATCTCTTAGGTCTGACACCTGATGGAGGAAGCAAGCTTCAGGTTTGGAAAAATGTCTGGAATTCATCGAGGACT
GATTCACCGCTCTTTGATGTGCAATCATCATACTTCAACGACTCCCATTGTCAAATTGCGAACCCTCATAGTAAT
GCCGTCGTAGACCTTAATGGTGATTGCTTGGCTGATGTCTTCCTTGTTTGTGATGAGGGCCGCGGACAGAAATCG
TTTCAGATCTGGCTCAACAAAAAGTCTCAAAGTTTTGTTCTGGCTATGCAAGGAAGCTTACCATCTGGTACACAA
AGTATCTCCTTTGCCGATATCGACAGAGATGGGCCGATGGACATGATATTCACGACATGTAAAGTGGTCTCTTCG
AGTGGAGTCGGTTCAGACTGTTACATTAACATTGCATATAACCAACAACTTCGTTTTATGTTCCTACACGACCGA
CTCTGGCATGAAGAATGGTGTACGAACAGCCCTGACAACAATGCTTTTGTTCGCTTTCCTGTTTCATCCCTTTTC
CGTGATGGTCACAAGCAATCCCTGCTTGTTTGGGATACGAGCTTTGATCCACCCATTCCCCTTTCATTACGCTTA
GGCGATGCCAATTTGGACGGCTTTCCCGATTTCCTGGCCATCTTTGCCTCAGGCAATGATCGGACACCGTATCTC
CCCTATTCCAAGCATTGTGCTTCTGGAGTTGCAGGGTGTGACAGTAAAGTTCGGGGGGGAAGAGGATGGGAGGTT
GCTACGAATTCCGGGATGAAGGCTCTAGCAAATGGTACACTTGACATCTTGGTGCAGCGGACTGGATTGCAGGAT
GGGAGCAAGGTTTTGTTTATTCAGAATAACTTTTACTATGATGCCTTTTTCTTAAAGGCAATCGCGCTCAATGGT
GCCTGTGATAGCGGATGGTGTTATTCTGCTAATGGGTCTGAACGCTACCATCCCTTCGGTGTCAGATATTCAGGA
GCAACGTACAAGTATACAGTATTCGATACATTAGGACATCGTTCAGCGGCTGAGTCAAAGTTTGTCTTTGTCACC
TCTTATCCTCTCTTGCCGCTAACACATGTTGAACCAATAGTTGGCCAACTTCCTCAAACGTCCTACCACGCGCTT
CAAACACCCTACTCATTTTTCGGCCTTGGTCGAACAAACAACTACATCGAGAATATGTTTGTCGGTACAACACTG
CATGCACCCGAACATTATATCAACATGGAAGGCAGTGTAATACCCAATTCTCGAGTCGTCATTCTACCACCTGCG
GATGGTGGTGAAAGTGGTGGAACATGGAAGCGAGAATTATTTTTGCGGTCTGGTGATTGGATTCCATGGGTGACT
GTTACTTGTGTTATTGGGATGGTAATTCTGGCCATAATTGTGTTTGTTTTGCATTTGAATGAGAAGAGAGAAGAT
GAGTTGGAGCGGAGGCGGATATCACATCATATCAATTTCGATGCTCTCTAA
Gene >Agabi119p4|590700
ATGGGTCAAGAAACAAATTCGAAAGAGATTGACATGTATCTCTATCAATCAATACCGAATAAAGGTTTTGGTACG
TTGCTGAATCATGCATATTTTACGACAACCTTGTTAAACGCGTCAATTAAAGATACTGCGAACCCAATACATGTT
CAAACATCAATTTCGTCGCAACCTATACCCCTGGATGTCAATGGAGATCTCAGAATTGATCTCTTAGGTCTGACA
CCTGATGGAGGAAGCAAGCTTCAGGTTTGGAAAAATGTCTGGAATTCATCGAGGACTGATTCACCGCTCTTTGAT
GTGTGAGTATTTCAAATTGGTTTCTCAATACCATTCACAAATGTCACGTAGGCAATCATCATACTTCAACGACTC
CCATTGTCAAATTGCGAACCCTCATAGTAATGCCGTCGTAGACCTTAATGGTGATTGCTTGGCTGGTGTGTACTC
ATGCGCAGGATGTGATATACTGGCTGTAACCAACGCGTGTTAGATGTCTTCCTTGTTTGTGATGAGGGCCGCGGA
CAGAAATCGTTTCAGATCTGGCTCAACAAAAAGTCTCAAAGTTTTGTTCTGGCTATGCAAGGAAGCTTACCATCT
GGTACACAAAGTATCTCCTTTGCCGATATCGGTAAACTCAAACATCGATTTGTTTCATAGATTGTCCACTGACAG
CTACACAGACAGAGATGGGCCGATGGACATGATATTCACGACATGTAAAGTGGTCTCTTCGAGTGGAGTCGGTTC
AGACTGTTACATTAACATTGCATATAACCAACAACTTCGTTTTATGTTCCTACACGACCGACTCTGGCATGAAGA
ATGGTGTACGAGTGTGTAGACCACCGAACGATCTTTGTACCGCCGATGACAACTTTCAATTCAATCTTCTAGACA
GCCCTGACAACAATGTCAGTTCCCGACTTCAATGTCCTTTCTACGCACTTATTTCAGTTATATAGGCTTTTGTTC
GCTTTCCTGTTTCATCCCTTTTCCGTGATGGTCACAAGCAATCCCTGCTTGTTTGGGATACGAGCTTTGATCCAC
CCATTCCCCTTTCATTACGCTTAGGCGATGCCAATTTGGACGGCTTTCCCGATTTCCTGGCCATCTTTGCCTCAG
GCAATGATCGGACACCGTATCTCCCCTATTCCAAGCATTGTGCTTCTGGAGTTGCAGGGTGTGACAGTAAAGTTC
GGGGGGGAAGAGGATGGGAGGTTGCTACGAATTCCGGGATGAAGGCTCTAGCAAATGTAAAAGACGCAAGGGGTG
TGGCATTTTTGGATATGGATGAAGATTTGAGTGATCTTCTATAAACAATTTTCTGCACGATGACAAGAGACTCAA
TGATATGTACAGGGTACACTTGACATCTTGGTGCAGCGGACTGGATTGCAGGATGGGAGCAAGGTTTTGTTTATT
CAGAATAACTTTTACTATGATGCCTTTTTCTTAAAGGCAATCGGTGCGTTTCTCTATGAGCCGGGTCTACGAAAA
GCTGATGAATCAATCAATATCTTTCCAGCGCTCAATGGTGCCTGTGATAGCGGATGGTGTTATTCTGCTAATGGG
TCTGAACGCTACCATGTAAAACCTTGCCATTGACTGATAGTCGAGTCCGTACTGATGGTTCATCGTAGCCCTTCG
GTGTCAGATATTCAGGAGCAACGTACAAGTATACAGTATTCGATACATTAGGACATCGTTCAGCGGCTGAGTCAA
AGTTTGTCTTTGTCACCTCTTATCCTCTCTTGCCGCTAACACATGTTGAACCAATAGTTGGCCAACTTCCTCAAA
CGTCCTACCACGCGCTTCAAACACCCTACTCATTTTTCGGCCTTGGTCGAACAAACAACTACATCGAGAATATGT
TTGTCGGTACAACACTGCATGCACCCGAACATTATATCAACATGGAAGGCAGTGTAATACCCAATTCTCGAGTCG
TCATTCTACCACCTGCGGATGGTGGTGAAAGTGGTGGAACATGGAAGCGAGAATTATTTTTGCGGTCTGGTGATT
GGATTCCATGGGTGACTGTTACTTGTGTTATTGGGATGGTAATTCTGGCCATAATTGTGTTTGTTTTGCATTTGA
ATGAGAAGGTGAGTTCGCGATTTTTTATAACGTGCTAAGAGGTAATTGTGGTGTGGAAGAGAGAAGATGAGTTGG
AGCGGAGGCGGATATCACATCATATCAATTTCGATGCTCTCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail