Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|590300
Gene name
Locationscaffold_02:2882990..2885060
Strand+
Gene length (bp)2070
Transcript length (bp)1464
Coding sequence length (bp)1464
Protein length (aa) 488

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00657 Lipase_GDSL GDSL-like Lipase/Acylhydrolase 2.2E-20 220 475
PF00734 CBM_1 Fungal cellulose binding domain 3.8E-14 161 189

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B7SIW2|XYNC_PHACH Endo-1,4-beta-xylanase C OS=Phanerochaete chrysosporium GN=xynC PE=1 SV=1 152 207 3.0E-17
sp|P49075|GUX3_AGABI Exoglucanase 3 OS=Agaricus bisporus GN=cel3 PE=1 SV=1 154 194 3.0E-14
sp|Q5AR04|MANF_EMENI Probable mannan endo-1,4-beta-mannosidase F OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=manF PE=3 SV=2 151 195 2.0E-13
sp|G0RV93|CIP2_HYPJQ 4-O-methyl-glucuronoyl methylesterase OS=Hypocrea jecorina (strain QM6a) GN=cip2 PE=1 SV=1 141 201 3.0E-13
sp|P46239|GUNF_FUSOX Putative endoglucanase type F OS=Fusarium oxysporum PE=2 SV=1 136 203 3.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B7SIW2|XYNC_PHACH Endo-1,4-beta-xylanase C OS=Phanerochaete chrysosporium GN=xynC PE=1 SV=1 152 207 3.0E-17
sp|P49075|GUX3_AGABI Exoglucanase 3 OS=Agaricus bisporus GN=cel3 PE=1 SV=1 154 194 3.0E-14
sp|Q5AR04|MANF_EMENI Probable mannan endo-1,4-beta-mannosidase F OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=manF PE=3 SV=2 151 195 2.0E-13
sp|G0RV93|CIP2_HYPJQ 4-O-methyl-glucuronoyl methylesterase OS=Hypocrea jecorina (strain QM6a) GN=cip2 PE=1 SV=1 141 201 3.0E-13
sp|P46239|GUNF_FUSOX Putative endoglucanase type F OS=Fusarium oxysporum PE=2 SV=1 136 203 3.0E-13
sp|Q7SDR1|GUN3_NEUCR Endoglucanase gh5-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gh5-1 PE=1 SV=1 138 225 9.0E-13
sp|Q9HEZ1|XYNA_PHACH Endo-1,4-beta-xylanase A OS=Phanerochaete chrysosporium GN=xynA PE=1 SV=1 153 208 1.0E-12
sp|Q4WFK4|CBHC_ASPFU Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cbhC PE=3 SV=1 139 195 3.0E-12
sp|B0XWL3|CBHC_ASPFC Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=cbhC PE=3 SV=1 139 195 3.0E-12
sp|B2ABX7|CEL6A_PODAN 1,4-beta-D-glucan cellobiohydrolase CEL6A OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=CEL6A PE=1 SV=1 162 202 5.0E-12
sp|A1DJQ7|CBHC_NEOFI Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=cbhC PE=3 SV=1 139 195 7.0E-12
sp|G4MPQ7|XYN6_MAGO7 Endo-1,4-beta-xylanase 6 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=XYL6 PE=3 SV=1 162 196 3.0E-11
sp|Q8NJ73|XYN6_MAGGR Endo-1,4-beta-xylanase 6 OS=Magnaporthe grisea GN=XYL6 PE=1 SV=1 162 196 3.0E-11
sp|Q4WBW4|AXE1_ASPFU Probable acetylxylan esterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=axeA PE=3 SV=1 162 193 6.0E-11
sp|Q9C1S9|GUX6_HUMIN Exoglucanase-6A OS=Humicola insolens GN=cel6A PE=1 SV=1 159 196 1.0E-10
sp|Q4WBS1|MANF_ASPFU Mannan endo-1,4-beta-mannosidase F OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=manF PE=1 SV=2 146 194 1.0E-10
sp|B0Y9E7|MANF_ASPFC Probable mannan endo-1,4-beta-mannosidase F OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=manF PE=3 SV=2 146 194 1.0E-10
sp|Q06886|GUX1_PENJA Exoglucanase 1 OS=Penicillium janthinellum GN=cbh1 PE=2 SV=1 162 193 2.0E-10
sp|I1S3C6|XYND_GIBZE Endo-1,4-beta-xylanase D OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=XYLD PE=1 SV=1 148 208 2.0E-10
sp|Q5B2E8|CBHC_EMENI 1,4-beta-D-glucan cellobiohydrolase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cbhC PE=1 SV=2 146 194 2.0E-10
sp|P07982|GUN2_HYPJE Endoglucanase EG-II OS=Hypocrea jecorina GN=egl2 PE=1 SV=1 157 205 4.0E-10
sp|A1DBV1|MANF_NEOFI Probable mannan endo-1,4-beta-mannosidase F OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=manF PE=3 SV=1 148 204 5.0E-10
sp|Q0CFP1|CBHC_ASPTN Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cbhC PE=3 SV=1 153 194 7.0E-10
sp|A1DBP9|AXE1_NEOFI Probable acetylxylan esterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=axeA PE=3 SV=1 162 193 7.0E-10
sp|Q12624|GUN3_HUMIN Endoglucanase 3 OS=Humicola insolens GN=CMC3 PE=1 SV=1 138 194 1.0E-09
sp|A1C8U0|MANF_ASPCL Mannan endo-1,4-beta-mannosidase F OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=manF PE=3 SV=1 146 216 2.0E-09
sp|Q8NJP6|AXE1_TALPU Acetylxylan esterase A OS=Talaromyces purpurogenus GN=axeA PE=1 SV=1 162 193 3.0E-09
sp|P07987|GUX2_HYPJE Exoglucanase 2 OS=Hypocrea jecorina GN=cbh2 PE=1 SV=1 152 195 3.0E-09
sp|Q9UVS8|CBHB_ASPNG 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus niger GN=cbhB PE=2 SV=1 156 193 7.0E-09
sp|A2QAI7|CBHB_ASPNC Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cbhB PE=3 SV=1 156 193 7.0E-09
sp|G4MM92|CEL6A_MAGO7 1,4-beta-D-glucan cellobiohydrolase CEL6A OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=cel6A PE=1 SV=1 162 195 7.0E-09
sp|B8NIV9|MANF_ASPFN Probable mannan endo-1,4-beta-mannosidase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=manF PE=3 SV=1 146 216 7.0E-09
sp|Q2U2I3|MANF_ASPOR Probable mannan endo-1,4-beta-mannosidase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=manF PE=3 SV=2 146 195 8.0E-09
sp|A1CCN4|CBHC_ASPCL Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cbhC PE=3 SV=1 155 195 9.0E-09
sp|A8PB24|AXE1_COPC7 Acetylxylan esterase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CC1G_12850 PE=1 SV=1 142 195 1.0E-08
sp|A2QYR9|CBHC_ASPNC Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cbhC PE=3 SV=1 150 195 6.0E-08
sp|Q99034|AXE1_HYPJE Acetylxylan esterase OS=Hypocrea jecorina GN=axe1 PE=1 SV=1 162 193 1.0E-07
sp|Q8J0K5|XYNB_TALFU Endo-1,4-beta-xylanase B OS=Talaromyces funiculosus GN=xynB PE=1 SV=1 162 192 1.0E-07
sp|Q0CMT2|CBHB_ASPTN Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cbhB PE=3 SV=1 162 193 1.0E-07
sp|G2Q9T3|CEL61_MYCTT Polysaccharide monooxygenase Cel61a OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) GN=Cel61a PE=1 SV=1 162 193 2.0E-07
sp|P0DKJ6|GDL4_ARATH GDSL esterase/lipase At1g20120 OS=Arabidopsis thaliana GN=At1g20120 PE=2 SV=1 269 481 2.0E-07
sp|Q94CH8|EXL1_ARATH GDSL esterase/lipase EXL1 OS=Arabidopsis thaliana GN=EXL1 PE=2 SV=1 274 446 3.0E-07
sp|Q8WZJ4|XYNA_TALFU 1,4-beta-D-glucan cellobiohydrolase xynA OS=Talaromyces funiculosus GN=xynA PE=1 SV=1 162 193 4.0E-07
sp|G2QCS4|CEL7A_MYCTT Endoglucanase 7a OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) GN=eg7A PE=1 SV=1 162 193 4.0E-07
sp|E9F9R9|CHI2_METRA Endochitinase 2 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) GN=chi2 PE=3 SV=2 160 192 4.0E-07
sp|P43317|GUN5_HYPJE Endoglucanase-5 OS=Hypocrea jecorina GN=egl5 PE=3 SV=1 156 194 6.0E-07
sp|Q99289|HLT_VIBPA Thermolabile hemolysin OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=VPA0226 PE=1 SV=2 260 449 6.0E-07
sp|Q8NK02|CBHB_EMENI 1,4-beta-D-glucan cellobiohydrolase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cbhB PE=3 SV=1 158 193 7.0E-07
sp|Q02290|XYNB_NEOPA Endo-1,4-beta-xylanase B OS=Neocallimastix patriciarum GN=xynB PE=2 SV=1 162 193 7.0E-07
sp|E7EF85|XYNB_PENOX Endo-1,4-beta-xylanase B OS=Penicillium oxalicum GN=xynB PE=1 SV=1 162 193 7.0E-07
sp|Q4U4T0|CHI2_METAN Endochitinase 2 OS=Metarhizium anisopliae GN=chi2 PE=1 SV=1 160 192 8.0E-07
sp|B2ADA5|GH6D_PODAN Probable exoglucanase GH6D OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=GH6D PE=3 SV=1 162 193 8.0E-07
sp|O59843|CBHB_ASPAC 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus aculeatus GN=cbhB PE=2 SV=1 162 193 1.0E-06
sp|P79046|XYN1_HUMGT Endo-1,4-beta-xylanase 1 OS=Humicola grisea var. thermoidea GN=xyn1 PE=2 SV=1 162 193 1.0E-06
sp|P10480|GCAT_AERHY Phosphatidylcholine-sterol acyltransferase OS=Aeromonas hydrophila PE=1 SV=3 186 448 1.0E-06
sp|Q5ZNB1|XYND_TALFU Endo-1,4-beta-xylanase D OS=Talaromyces funiculosus GN=xynD PE=1 SV=1 162 193 1.0E-06
sp|A1DNL0|CBHB_NEOFI Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=cbhB PE=3 SV=1 162 193 2.0E-06
sp|Q9FK75|GDL82_ARATH GDSL esterase/lipase At5g45670 OS=Arabidopsis thaliana GN=At5g45670 PE=2 SV=1 256 446 2.0E-06
sp|Q9SIF3|GDL33_ARATH GDSL esterase/lipase At2g04020 OS=Arabidopsis thaliana GN=At2g04020 PE=3 SV=2 198 384 3.0E-06
sp|B8M9H9|FAEB_TALSN Feruloyl esterase B OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=faeB PE=1 SV=1 162 193 3.0E-06
sp|Q9P8P3|GUX1_TRIHA Exoglucanase 1 OS=Trichoderma harzianum GN=cbh1 PE=1 SV=1 162 193 3.0E-06
sp|Q9SYF5|GLIP3_ARATH GDSL esterase/lipase 3 OS=Arabidopsis thaliana GN=GLIP3 PE=2 SV=2 274 455 3.0E-06
sp|Q94CH6|EXL3_ARATH GDSL esterase/lipase EXL3 OS=Arabidopsis thaliana GN=EXL3 PE=2 SV=1 196 473 3.0E-06
sp|Q4WM08|CBHB_ASPFU Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cbhB PE=1 SV=1 162 193 4.0E-06
sp|B0Y8K2|CBHB_ASPFC Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=cbhB PE=3 SV=1 162 193 4.0E-06
sp|B7SIW1|XYNB_PHACH Endo-1,4-beta-xylanase B OS=Phanerochaete chrysosporium GN=xynB PE=1 SV=1 155 193 5.0E-06
sp|P46236|GUNB_FUSOX Putative endoglucanase type B OS=Fusarium oxysporum PE=2 SV=1 162 206 5.0E-06
sp|Q7Z9M8|XG74_HYPJQ Xyloglucanase OS=Hypocrea jecorina (strain QM6a) GN=cel74a PE=1 SV=1 164 193 7.0E-06
sp|A1CU44|CBHB_ASPCL Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cbhB PE=3 SV=1 162 193 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0030248 cellulose binding Yes
GO:0005576 extracellular region Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0016788 hydrolase activity, acting on ester bonds Yes
GO:0030247 polysaccharide binding No
GO:0016787 hydrolase activity No
GO:0030246 carbohydrate binding No
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0005488 binding No
GO:0110165 cellular anatomical entity No
GO:0003674 molecular_function No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|590300
MFSSSSFPSLFFRLLYDSAILRTWFLGNETLILKDMTNKKYLLLCGESISSDNSSLLLMTGIPEIFRIPFAAYLN
TLMRTSSSFYRSSLDSSGYILGGNTHMTLARDDIRNIDGNSCRYFILAGSPDDKSTAKHTMQRLSILSKFVCLAA
LVPLVAAQSPAWGQCGGNGWTGPTSCVSGYTCVEQNEWYSQCIPGTVTTTTAPPTTTPPVSIPSNAKYWFSFGDS
YTQTGFQPTGALPSPGNALGNPPYPGFTATGGENWVDYVTTQYNKTLLLTYNYAYGGATIDANLVQPFDPSVLSM
TDQINQFLSGAGKKPTSTPWTSDNSLFSFFIGINDIGNSWYLPGDRDAFSDTLLNAYFALVQKAYDVGARNFLFV
NVPPIDRSPLQLSSDQASRDAEAAVINGFNTKLVSKINSFKSANRNVTTYVWDSHTQFTAMLDDPQAYGFKDSTS
FGSAPDQFWGNNYHPSSYAHKFFGQTVGNDVLKSTVF*
Coding >Agabi119p4|590300
ATGTTTAGCTCTAGTTCGTTTCCCTCTCTTTTTTTCCGTTTACTTTACGATTCTGCAATCCTTCGGACTTGGTTC
TTGGGTAACGAAACGCTGATACTGAAAGATATGACGAACAAGAAATATCTCCTTTTATGTGGAGAGTCAATCAGC
TCGGACAACTCTTCTCTACTTCTCATGACAGGCATACCGGAGATTTTCCGGATACCCTTCGCCGCATATCTGAAT
ACCCTCATGCGCACTTCCTCCAGCTTCTATCGTAGCAGCCTTGACAGTTCCGGATATATTCTTGGCGGAAATACC
CACATGACCTTGGCACGAGATGACATTCGCAACATCGACGGAAATAGCTGCAGATATTTTATACTCGCAGGTTCC
CCTGATGACAAGTCTACGGCGAAACATACAATGCAGCGTCTTTCCATTTTGTCAAAATTCGTTTGTCTAGCTGCC
TTGGTTCCCTTGGTGGCAGCCCAATCACCGGCTTGGGGTCAATGTGGTGGTAATGGTTGGACTGGGCCAACGAGT
TGTGTTTCTGGGTATACATGTGTAGAACAGAATGAATGGTATTCTCAGTGCATCCCCGGAACCGTTACCACAACC
ACGGCTCCTCCCACCACGACTCCCCCCGTTTCAATACCGAGTAATGCGAAGTATTGGTTCAGCTTTGGCGACTCC
TACACTCAAACTGGCTTTCAGCCTACCGGAGCCCTCCCTTCACCTGGTAACGCCCTTGGAAACCCACCTTATCCA
GGTTTCACAGCTACCGGCGGGGAGAATTGGGTCGATTATGTCACCACTCAATACAACAAAACACTTCTCCTGACT
TACAACTACGCTTATGGTGGTGCTACGATCGATGCTAACCTCGTTCAACCTTTCGATCCCAGTGTTCTATCCATG
ACGGATCAAATCAACCAATTCTTGAGCGGGGCAGGCAAAAAGCCCACGAGTACGCCTTGGACATCTGATAACTCT
CTGTTTTCCTTTTTCATTGGCATCAATGATATTGGAAACAGCTGGTATCTACCTGGTGATCGCGATGCATTTTCG
GATACTTTGCTTAACGCATACTTCGCGCTTGTGCAGAAAGCCTATGACGTGGGCGCTCGAAACTTTCTCTTCGTC
AACGTCCCTCCGATAGACAGGTCTCCTCTGCAACTGTCTTCGGATCAAGCCTCTCGTGACGCTGAAGCTGCAGTG
ATTAATGGATTCAACACCAAACTTGTCTCAAAAATCAATAGCTTCAAGTCTGCAAACCGTAATGTTACGACTTAC
GTGTGGGACTCGCATACACAATTCACCGCTATGCTTGATGATCCGCAAGCTTATGGTTTCAAAGATAGCACTAGC
TTTGGCAGTGCTCCCGATCAGTTCTGGGGTAACAATTACCATCCCAGCAGCTACGCTCACAAATTCTTTGGTCAA
ACCGTCGGGAACGACGTCCTGAAAAGCACAGTTTTCTGA
Transcript >Agabi119p4|590300
ATGTTTAGCTCTAGTTCGTTTCCCTCTCTTTTTTTCCGTTTACTTTACGATTCTGCAATCCTTCGGACTTGGTTC
TTGGGTAACGAAACGCTGATACTGAAAGATATGACGAACAAGAAATATCTCCTTTTATGTGGAGAGTCAATCAGC
TCGGACAACTCTTCTCTACTTCTCATGACAGGCATACCGGAGATTTTCCGGATACCCTTCGCCGCATATCTGAAT
ACCCTCATGCGCACTTCCTCCAGCTTCTATCGTAGCAGCCTTGACAGTTCCGGATATATTCTTGGCGGAAATACC
CACATGACCTTGGCACGAGATGACATTCGCAACATCGACGGAAATAGCTGCAGATATTTTATACTCGCAGGTTCC
CCTGATGACAAGTCTACGGCGAAACATACAATGCAGCGTCTTTCCATTTTGTCAAAATTCGTTTGTCTAGCTGCC
TTGGTTCCCTTGGTGGCAGCCCAATCACCGGCTTGGGGTCAATGTGGTGGTAATGGTTGGACTGGGCCAACGAGT
TGTGTTTCTGGGTATACATGTGTAGAACAGAATGAATGGTATTCTCAGTGCATCCCCGGAACCGTTACCACAACC
ACGGCTCCTCCCACCACGACTCCCCCCGTTTCAATACCGAGTAATGCGAAGTATTGGTTCAGCTTTGGCGACTCC
TACACTCAAACTGGCTTTCAGCCTACCGGAGCCCTCCCTTCACCTGGTAACGCCCTTGGAAACCCACCTTATCCA
GGTTTCACAGCTACCGGCGGGGAGAATTGGGTCGATTATGTCACCACTCAATACAACAAAACACTTCTCCTGACT
TACAACTACGCTTATGGTGGTGCTACGATCGATGCTAACCTCGTTCAACCTTTCGATCCCAGTGTTCTATCCATG
ACGGATCAAATCAACCAATTCTTGAGCGGGGCAGGCAAAAAGCCCACGAGTACGCCTTGGACATCTGATAACTCT
CTGTTTTCCTTTTTCATTGGCATCAATGATATTGGAAACAGCTGGTATCTACCTGGTGATCGCGATGCATTTTCG
GATACTTTGCTTAACGCATACTTCGCGCTTGTGCAGAAAGCCTATGACGTGGGCGCTCGAAACTTTCTCTTCGTC
AACGTCCCTCCGATAGACAGGTCTCCTCTGCAACTGTCTTCGGATCAAGCCTCTCGTGACGCTGAAGCTGCAGTG
ATTAATGGATTCAACACCAAACTTGTCTCAAAAATCAATAGCTTCAAGTCTGCAAACCGTAATGTTACGACTTAC
GTGTGGGACTCGCATACACAATTCACCGCTATGCTTGATGATCCGCAAGCTTATGGTTTCAAAGATAGCACTAGC
TTTGGCAGTGCTCCCGATCAGTTCTGGGGTAACAATTACCATCCCAGCAGCTACGCTCACAAATTCTTTGGTCAA
ACCGTCGGGAACGACGTCCTGAAAAGCACAGTTTTCTGA
Gene >Agabi119p4|590300
ATGTTTAGCTCTAGTTCGTTTCCCTCTCTTTTTTTCCGTTTACTTTACGATTCTGCAATCCTTCGGACTTGGTTC
TTGGGTAACGAAACGCTGATACTGGTACTTTCTCATCTTGCCCTTTTCAATGTTGCAACGGACTTACTATCAAGA
TAATTTAGAAAGATATGACGAACAAGAAATATCTCCTTTTATGTGGAGAGTGAACACATCCTTAACATGGGTCAG
CATATGTTTCTTTCATAACTTTGCCGCACGAAGTCTCAGGTCAATCAGCTCGGACAACTCTTCTCTACTTCTCAT
GACAGGCATACCGGAGATTTTCCGGATACCCTTCGCCGCATATCTGAATACCCTCATGCGCACTTCCTCCAGCTT
CTATCGTAGCAGCCTTGACAGTTCCGGATATATTCTTGGCGGAAATACCCACATGACCTTGGCACGAGATGACAT
TCGCAACATCGACGGAAATAGCTGCAGATATTTTATACTCGCAGGTTCCCCTGATGACAAGTCTACGGCGAAACA
TACAATGCAGCGTCTTTCCATTTTGTCAAAATTCGTTTGTCTAGCTGCCTTGGTTCCCTTGGTGGCAGCCCAATC
ACCGGCTTGGGGTCAATGTATGTTGGATCTCTTCATCTCACTACTCGTCATTGATATTCGAAAGGTGGTGGTAAT
GGTTGGACTGGGCCAACGAGTTGTGTTTCTGGGTAAGACCGACGTTTCTTGAAGATGAAATTCTTTCTAACGCGA
AGCAGGTATACATGTGTAGAACAGAATGAATGTAAGCTTCCCGTCTGTTCAGCTTTCTGAGGCTGACACGGGTAC
ATTGTGACCAAAGGGTATTCTCAGTGCATCCCCGGAACCGTTACCACAACCACGGCTCCTCCCACCACGACTCCC
CCCGTTTCAATACCGAGTAATGCGAAGTATTGGTTCAGCTTGTAAGCACTTCATTTCCTACGAGGTAACGCTGAC
GTCAAACCATCAACGTCAGTGGCGACTCCTACACTCAAACTGGCTTTCAGCCTACCGGAGCCCTCCCTTCACCTG
GTAACGCCCTTGGAAACCCACCTTATCCAGGTTTCACAGCTACCGGCGGGGAGAATTGGGTCGATTATGTCACCA
CTCAATACAACAAAACACTTCTCCTGACTTACAACTACGCTTATGGTGGTGCTACGATCGATGCTAACCTCGTTC
AACCTTTCGATCCCAGTGTTCTATCCATGACGGATCAAATCAACCAATTCTTGAGCGGGGCAGGCAAAAAGCCCA
CGAGTACGCCTTGGACATCTGATAACTCTCTGTTTTCCTTTTTCATTGGCATCAATGATATTGGAAACAGCTGGT
ATCTACCTGGTGATCGCGATGCGTAAGTCTCTGATGTAACTAGTCGTTTTCAATTTACTAAAAACATGTTGAAAA
GATTTTCGGATACTTTGCTTAACGCATACTTCGCGCTTGTGCAGAAAGCCTAGTAAGCATTTTTCAAATCAGTTT
TATTTACAGTACGTGATTCTCAACACCACTCATCCAGTGACGTGGGCGCTCGAAACTTTCTCTTCGTCAACGTCC
CTCCGATAGACAGGTCTCCTCTGGTACGTTGGCGGGTATATCTAGACTGACGTCGTTTATGAACATTCTTCCAAA
CTTAGCAACTGTCTTCGGATCAAGCCTCTCGTGACGCTGAAGCTGCAGTGATTAATGGATTCAACACCAAACTTG
TCTCAAAAATCAATAGCTTCAAGTCTGCAAACCGTAATGTAAGTTGTTCTATTATTCAATCACGCCTCACAGAAT
TAACATCATTGTCATAGGTTACGACTTACGTGTGGGACTCGCATACACAATTCACCGCTATGCTTGATGATCCGC
AAGCTTATGGTTTCAAAGATAGCACTAGCTTTGGCAGTGCTCCCGATCAGTTCTGGGGGTGAATACTTTTTGGGT
CTTGACTTATCTTCCAAGCTGAACCCTTTTTCTAGTAACAATTACCATCCCAGCAGCTACGCTCACAAATTCTTT
GGTCAAACCGTCGGGAACGACGTCCTGAAAAGCACAGTTTTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail