Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|589900
Gene name
Locationscaffold_02:2828724..2834056
Strand+
Gene length (bp)5332
Transcript length (bp)5286
Coding sequence length (bp)5286
Protein length (aa) 1762

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17917 RT_RNaseH RNase H-like domain found in reverse transcriptase 6.5E-29 1097 1197
PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase) 1.4E-19 851 1013
PF17921 Integrase_H2C2 Integrase zinc binding domain 2.1E-17 1320 1374
PF17919 RT_RNaseH_2 RNase H-like domain found in reverse transcriptase 7.0E-16 1079 1167
PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain 1.1E-08 1705 1753
PF13650 Asp_protease_2 Aspartyl protease 6.5E-06 531 614
PF08284 RVP_2 Retroviral aspartyl protease 1.5E-05 533 632

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q99315|YG31B_YEAST Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-G PE=1 SV=3 782 1690 9.0E-109
sp|P0CT39|TF26_SCHPO Transposon Tf2-6 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-6 PE=3 SV=1 812 1687 2.0E-107
sp|P0CT38|TF25_SCHPO Transposon Tf2-5 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-5 PE=3 SV=1 812 1687 2.0E-107
sp|P0CT36|TF23_SCHPO Transposon Tf2-3 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-3 PE=1 SV=1 812 1687 2.0E-107
sp|P0CT41|TF212_SCHPO Transposon Tf2-12 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-12 PE=3 SV=1 812 1687 2.0E-107
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q99315|YG31B_YEAST Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-G PE=1 SV=3 782 1690 9.0E-109
sp|P0CT39|TF26_SCHPO Transposon Tf2-6 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-6 PE=3 SV=1 812 1687 2.0E-107
sp|P0CT38|TF25_SCHPO Transposon Tf2-5 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-5 PE=3 SV=1 812 1687 2.0E-107
sp|P0CT36|TF23_SCHPO Transposon Tf2-3 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-3 PE=1 SV=1 812 1687 2.0E-107
sp|P0CT41|TF212_SCHPO Transposon Tf2-12 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-12 PE=3 SV=1 812 1687 2.0E-107
sp|P0CT40|TF29_SCHPO Transposon Tf2-9 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-9 PE=3 SV=1 812 1687 3.0E-107
sp|P0CT37|TF24_SCHPO Transposon Tf2-4 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-4 PE=3 SV=1 812 1687 3.0E-107
sp|P0CT35|TF22_SCHPO Transposon Tf2-2 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-2 PE=3 SV=1 812 1687 3.0E-107
sp|P0CT34|TF21_SCHPO Transposon Tf2-1 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-1 PE=3 SV=1 812 1687 3.0E-107
sp|P0CT43|TF28_SCHPO Transposon Tf2-8 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-8 PE=3 SV=1 812 1687 8.0E-107
sp|P0CT42|TF27_SCHPO Transposon Tf2-7 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-7 PE=3 SV=1 812 1687 8.0E-107
sp|Q9UR07|TF211_SCHPO Transposon Tf2-11 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-11 PE=3 SV=1 812 1687 1.0E-106
sp|Q7LHG5|YI31B_YEAST Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-I PE=3 SV=2 782 1675 2.0E-105
sp|P04323|POL3_DROME Retrovirus-related Pol polyprotein from transposon 17.6 OS=Drosophila melanogaster GN=pol PE=3 SV=1 813 1466 6.0E-73
sp|Q8I7P9|POL5_DROME Retrovirus-related Pol polyprotein from transposon opus OS=Drosophila melanogaster GN=pol PE=3 SV=1 752 1222 3.0E-71
sp|P20825|POL2_DROME Retrovirus-related Pol polyprotein from transposon 297 OS=Drosophila melanogaster GN=pol PE=3 SV=1 784 1466 1.0E-68
sp|P10394|POL4_DROME Retrovirus-related Pol polyprotein from transposon 412 OS=Drosophila melanogaster GN=POL PE=3 SV=1 811 1645 3.0E-67
sp|P10401|POLY_DROME Retrovirus-related Pol polyprotein from transposon gypsy OS=Drosophila melanogaster GN=pol PE=3 SV=1 763 1536 1.0E-64
sp|Q00962|POL_CAMVN Enzymatic polyprotein OS=Cauliflower mosaic virus (strain NY8153) GN=ORF V PE=3 SV=1 821 1217 2.0E-43
sp|P05400|POL_CERV Enzymatic polyprotein OS=Carnation etched ring virus GN=ORF V PE=3 SV=1 821 1215 5.0E-43
sp|P03555|POL_CAMVC Enzymatic polyprotein OS=Cauliflower mosaic virus (strain CM-1841) GN=ORF V PE=3 SV=1 821 1217 2.0E-42
sp|Q02964|POL_CAMVE Enzymatic polyprotein OS=Cauliflower mosaic virus (strain BBC) GN=ORF V PE=3 SV=1 821 1217 2.0E-42
sp|P03554|POL_CAMVS Enzymatic polyprotein OS=Cauliflower mosaic virus (strain Strasbourg) GN=ORF V PE=3 SV=1 821 1217 9.0E-42
sp|Q89703|POL_CSVMV Putative enzymatic polyprotein OS=Cassava vein mosaic virus GN=ORF 3 PE=3 SV=1 798 1217 5.0E-41
sp|P03556|POL_CAMVD Enzymatic polyprotein OS=Cauliflower mosaic virus (strain D/H) GN=ORF V PE=3 SV=1 821 1217 8.0E-41
sp|P09523|POL_FMVD Enzymatic polyprotein OS=Figwort mosaic virus (strain DxS) GN=ORF V PE=3 SV=1 821 1217 3.0E-39
sp|P15629|POL_SOCMV Enzymatic polyprotein OS=Soybean chlorotic mottle virus GN=ORF V PE=3 SV=2 822 1217 9.0E-37
sp|Q7TD08|POL_CYLCV Enzymatic polyprotein OS=Cestrum yellow leaf curling virus GN=ORF V PE=3 SV=1 823 1217 1.0E-35
sp|P19199|POL_COYMV Polyprotein P3 OS=Commelina yellow mottle virus PE=3 SV=2 822 1218 2.0E-34
sp|Q91DM0|POLG_PVCV1 Genome polyprotein OS=Petunia vein clearing virus (isolate Shepherd) PE=3 SV=1 826 1338 1.0E-31
sp|Q6XKE6|POLG_PVCV2 Genome polyprotein OS=Petunia vein clearing virus (isolate Hohn) PE=3 SV=1 826 1338 1.0E-31
sp|P27502|POL_RTBVP Polyprotein P3 OS=Rice tungro bacilliform virus (isolate Philippines) PE=1 SV=1 799 1217 3.0E-27
sp|P14350|POL_FOAMV Pro-Pol polyprotein OS=Human spumaretrovirus GN=pol PE=1 SV=2 788 1203 5.0E-23
sp|O93209|POL_FFV Pro-Pol polyprotein OS=Feline foamy virus GN=pol PE=3 SV=1 775 1195 6.0E-23
sp|P27401|POL_SFV3L Pro-Pol polyprotein OS=Simian foamy virus type 3 (strain LK3) GN=pol PE=3 SV=2 812 1203 6.0E-23
sp|O92815|POL_WDSV Gag-Pol polyprotein OS=Walleye dermal sarcoma virus GN=gag-pol PE=1 SV=2 759 1201 7.0E-23
sp|P23074|POL_SFV1 Pro-Pol polyprotein OS=Simian foamy virus type 1 GN=pol PE=1 SV=3 793 1203 8.0E-23
sp|Q87040|POL_SFVCP Pro-Pol polyprotein OS=Simian foamy virus (isolate chimpanzee) GN=pol PE=3 SV=1 788 1203 1.0E-22
sp|P27401|POL_SFV3L Pro-Pol polyprotein OS=Simian foamy virus type 3 (strain LK3) GN=pol PE=3 SV=2 1286 1580 1.0E-20
sp|P21414|POL_GALV Pol polyprotein OS=Gibbon ape leukemia virus GN=pol PE=3 SV=1 812 1171 1.0E-20
sp|P23074|POL_SFV1 Pro-Pol polyprotein OS=Simian foamy virus type 1 GN=pol PE=1 SV=3 1312 1581 2.0E-20
sp|Q9TTC1|POL_KORV Pro-Pol polyprotein OS=Koala retrovirus GN=pro-pol PE=3 SV=1 812 1237 3.0E-20
sp|Q87040|POL_SFVCP Pro-Pol polyprotein OS=Simian foamy virus (isolate chimpanzee) GN=pol PE=3 SV=1 1288 1581 1.0E-19
sp|P31792|POL_FENV1 Pol polyprotein (Fragment) OS=Feline endogenous virus ECE1 GN=pol PE=3 SV=1 782 1171 6.0E-19
sp|P14350|POL_FOAMV Pro-Pol polyprotein OS=Human spumaretrovirus GN=pol PE=1 SV=2 1310 1580 2.0E-18
sp|P10272|POL_BAEVM Pol polyprotein OS=Baboon endogenous virus (strain M7) GN=pol PE=3 SV=1 768 1171 1.0E-17
sp|O93209|POL_FFV Pro-Pol polyprotein OS=Feline foamy virus GN=pol PE=3 SV=1 1322 1576 2.0E-15
sp|Q09575|YRD6_CAEEL Uncharacterized protein K02A2.6 OS=Caenorhabditis elegans GN=K02A2.6 PE=3 SV=1 1305 1535 2.0E-15
sp|P31843|RRPO_OENBE RNA-directed DNA polymerase homolog OS=Oenothera berteroana PE=4 SV=1 859 986 5.0E-15
sp|Q2F7J0|POL_XMRV4 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP42) GN=gag-pol PE=3 SV=1 800 1171 7.0E-14
sp|A1Z651|POL_XMRV6 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP62) GN=gag-pol PE=1 SV=1 800 1171 7.0E-14
sp|Q2F7J3|POL_XMRV3 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP35) GN=gag-pol PE=1 SV=1 800 1171 8.0E-14
sp|P03355|POL_MLVMS Gag-Pol polyprotein OS=Moloney murine leukemia virus (isolate Shinnick) GN=gag-pol PE=1 SV=4 1266 1652 2.0E-13
sp|P03355|POL_MLVMS Gag-Pol polyprotein OS=Moloney murine leukemia virus (isolate Shinnick) GN=gag-pol PE=1 SV=4 800 1171 4.0E-13
sp|P26808|POL_MLVFP Pol polyprotein OS=Friend murine leukemia virus (isolate PVC-211) GN=pol PE=3 SV=1 800 1140 5.0E-13
sp|P03356|POL_MLVAV Pol polyprotein OS=AKV murine leukemia virus GN=pol PE=3 SV=2 800 1171 6.0E-13
sp|P26810|POL_MLVF5 Pol polyprotein OS=Friend murine leukemia virus (isolate 57) GN=pol PE=3 SV=1 1266 1652 7.0E-13
sp|Q09575|YRD6_CAEEL Uncharacterized protein K02A2.6 OS=Caenorhabditis elegans GN=K02A2.6 PE=3 SV=1 842 1045 9.0E-13
sp|P03363|POL_HTLV2 Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 2 GN=gag-pro-pol PE=1 SV=4 828 1065 9.0E-13
sp|P26808|POL_MLVFP Pol polyprotein OS=Friend murine leukemia virus (isolate PVC-211) GN=pol PE=3 SV=1 1266 1652 1.0E-12
sp|P26809|POL_MLVFF Pol polyprotein OS=Friend murine leukemia virus (isolate FB29) GN=pol PE=3 SV=1 800 1140 1.0E-12
sp|P26809|POL_MLVFF Pol polyprotein OS=Friend murine leukemia virus (isolate FB29) GN=pol PE=3 SV=1 1266 1652 1.0E-12
sp|P21414|POL_GALV Pol polyprotein OS=Gibbon ape leukemia virus GN=pol PE=3 SV=1 1322 1652 2.0E-12
sp|Q9TTC1|POL_KORV Pro-Pol polyprotein OS=Koala retrovirus GN=pro-pol PE=3 SV=1 1324 1652 4.0E-12
sp|P31795|POL_MLVRK Pol polyprotein (Fragment) OS=Radiation murine leukemia virus (strain Kaplan) GN=pol PE=3 SV=1 1300 1652 8.0E-12
sp|P03356|POL_MLVAV Pol polyprotein OS=AKV murine leukemia virus GN=pol PE=3 SV=2 1300 1652 1.0E-11
sp|P26810|POL_MLVF5 Pol polyprotein OS=Friend murine leukemia virus (isolate 57) GN=pol PE=3 SV=1 800 1140 1.0E-11
sp|P11227|POL_MLVRD Pol polyprotein OS=Radiation murine leukemia virus GN=pol PE=3 SV=1 800 1140 1.0E-11
sp|P11227|POL_MLVRD Pol polyprotein OS=Radiation murine leukemia virus GN=pol PE=3 SV=1 1300 1652 1.0E-11
sp|P10272|POL_BAEVM Pol polyprotein OS=Baboon endogenous virus (strain M7) GN=pol PE=3 SV=1 1310 1652 3.0E-11
sp|P92523|M860_ARATH Uncharacterized mitochondrial protein AtMg00860 OS=Arabidopsis thaliana GN=AtMg00860 PE=4 SV=1 983 1096 5.0E-11
sp|P11283|POL_MMTVC Gag-Pro-Pol polyprotein OS=Mouse mammary tumor virus (strain C3H) GN=gag-pro-pol PE=1 SV=2 828 1073 5.0E-11
sp|Q4U0X6|POL_HTL3P Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 3 (strain Pyl43) GN=gag-pro-pol PE=3 SV=4 828 1065 6.0E-11
sp|P03365|POL_MMTVB Pol polyprotein OS=Mouse mammary tumor virus (strain BR6) GN=pol PE=3 SV=2 825 1073 8.0E-11
sp|Q0R5R2|POL_HTL32 Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 3 (strain 2026ND) GN=gag-pro-pol PE=3 SV=3 828 1065 1.0E-10
sp|A1Z651|POL_XMRV6 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP62) GN=gag-pol PE=1 SV=1 1266 1652 2.0E-10
sp|P17283|POL_SIVCZ Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate CPZ GAB1) GN=gag-pol PE=3 SV=2 826 1096 2.0E-10
sp|P03362|POL_HTL1A Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 1 (strain Japan ATK-1 subtype A) GN=gag-pro-pol PE=1 SV=3 828 1073 2.0E-10
sp|Q2F7J0|POL_XMRV4 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP42) GN=gag-pol PE=3 SV=1 1266 1652 3.0E-10
sp|O89940|POL_HV1SE Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype G (isolate SE6165) GN=gag-pol PE=3 SV=3 826 1072 3.0E-10
sp|P07572|POL_MPMV Pol polyprotein OS=Mason-Pfizer monkey virus GN=pol PE=3 SV=1 802 1054 4.0E-10
sp|P03364|POL_SMRVH Pol polyprotein OS=Squirrel monkey retrovirus GN=pol PE=3 SV=2 828 974 4.0E-10
sp|P0C211|POL_HTL1L Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 1 (isolate Melanesia mel5 subtype C) GN=gag-pro-pol PE=3 SV=2 828 1065 6.0E-10
sp|Q9Q720|POL_HV1V9 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype H (isolate VI991) GN=gag-pol PE=3 SV=3 827 1058 9.0E-10
sp|Q2F7J3|POL_XMRV3 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP35) GN=gag-pol PE=1 SV=1 1266 1652 1.0E-09
sp|P14078|POL_HTL1C Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 1 (isolate Caribbea HS-35 subtype A) GN=gag-pro-pol PE=3 SV=3 828 1073 1.0E-09
sp|P08361|POL_MLVCB Gag-Pol polyprotein (Fragment) OS=Cas-Br-E murine leukemia virus GN=gag-pol PE=3 SV=1 1398 1652 2.0E-09
sp|Q9QBZ9|POL_HV197 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype K (isolate 97ZR-EQTB11) GN=gag-pol PE=3 SV=2 827 1059 3.0E-09
sp|P31792|POL_FENV1 Pol polyprotein (Fragment) OS=Feline endogenous virus ECE1 GN=pol PE=3 SV=1 1310 1652 4.0E-09
sp|O91080|POL_HV1YF Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group N (isolate YBF30) GN=gag-pol PE=3 SV=3 827 1057 4.0E-09
sp|P03360|POL_AVIRE Pol polyprotein (Fragment) OS=Avian reticuloendotheliosis virus GN=pol PE=3 SV=1 1310 1690 4.0E-09
sp|Q9IDV9|POL_HV1YB Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group N (isolate YBF106) GN=gag-pol PE=1 SV=3 827 1058 5.0E-09
sp|P35963|POL_HV1Y2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) GN=gag-pol PE=1 SV=3 827 1078 8.0E-09
sp|Q9QSR3|POL_HV1VI Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype F1 (isolate VI850) GN=gag-pol PE=3 SV=3 827 1059 8.0E-09
sp|O93215|POL_HV190 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype H (isolate 90CF056) GN=gag-pol PE=3 SV=4 827 1058 1.0E-08
sp|A6NKG5|RTL1_HUMAN Retrotransposon-like protein 1 OS=Homo sapiens GN=RTL1 PE=3 SV=3 933 1200 1.0E-08
sp|P12499|POL_HV1Z2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype D (isolate Z2/CDC-Z34) GN=gag-pol PE=1 SV=3 827 1078 1.0E-08
sp|P04587|POL_HV1B5 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH5) GN=gag-pol PE=1 SV=3 827 1078 2.0E-08
sp|Q9QBZ5|POL_HV1MP Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype F2 (isolate MP255) GN=gag-pol PE=3 SV=3 827 1057 2.0E-08
sp|P04025|POL_SRV1 Pol polyprotein OS=Simian retrovirus SRV-1 GN=pol PE=3 SV=1 825 1054 4.0E-08
sp|P03366|POL_HV1B1 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH10) GN=gag-pol PE=1 SV=3 827 1078 4.0E-08
sp|P18802|POL_HV1ND Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype D (isolate NDK) GN=gag-pol PE=3 SV=3 827 1078 4.0E-08
sp|O89290|POL_HV193 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype F1 (isolate 93BR020) GN=gag-pol PE=3 SV=3 827 1059 4.0E-08
sp|P04585|POL_HV1H2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) GN=gag-pol PE=1 SV=4 827 1078 4.0E-08
sp|P03367|POL_HV1BR Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BRU/LAI) GN=gag-pol PE=1 SV=3 827 1078 5.0E-08
sp|P0C6F2|POL_HV1LW Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate LW123) GN=gag-pol PE=1 SV=1 827 1078 5.0E-08
sp|Q1A267|POL_SIVMB Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate MB66) GN=gag-pol PE=3 SV=4 827 1094 8.0E-08
sp|P03369|POL_HV1A2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate ARV2/SF2) GN=gag-pol PE=1 SV=3 827 1094 8.0E-08
sp|P04588|POL_HV1MA Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype A (isolate MAL) GN=gag-pol PE=1 SV=3 826 1059 9.0E-08
sp|O12158|POL_HV192 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype C (isolate 92BR025) GN=gag-pol PE=1 SV=2 827 1059 9.0E-08
sp|Q1A249|POL_SIVEK Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate EK505) GN=gag-pol PE=3 SV=3 827 1059 1.0E-07
sp|Q52QI2|RTL1_BOVIN Retrotransposon-like protein 1 OS=Bos taurus GN=RTL1 PE=2 SV=2 887 1091 1.0E-07
sp|Q74120|POL_HV2KR Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate KR) GN=gag-pol PE=3 SV=3 812 971 1.0E-07
sp|Q9QBY3|POL_HV196 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype K (isolate 96CM-MP535) GN=gag-pol PE=3 SV=3 827 1059 1.0E-07
sp|P05961|POL_HV1MN Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate MN) GN=gag-pol PE=1 SV=3 827 1078 1.0E-07
sp|P20892|POL_HV1OY Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate OYI) GN=gag-pol PE=3 SV=3 827 1078 2.0E-07
sp|P17757|POL_HV2D1 Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate D194) GN=gag-pol PE=3 SV=3 822 998 2.0E-07
sp|O41798|POL_HV19N Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype G (isolate 92NG083) GN=gag-pol PE=3 SV=3 826 1059 2.0E-07
sp|P24107|POL_HV2CA Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate CAM2) GN=gag-pol PE=3 SV=3 812 989 2.0E-07
sp|P18096|POL_HV2BE Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate BEN) GN=gag-pol PE=3 SV=4 822 998 2.0E-07
sp|P03359|POL_WMSV Pol polyprotein (Fragment) OS=Woolly monkey sarcoma virus GN=pol PE=3 SV=1 1398 1652 2.0E-07
sp|P24740|POL_HV1U4 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype A (isolate U455) GN=gag-pol PE=1 SV=3 827 1049 2.0E-07
sp|Q75002|POL_HV1ET Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype C (isolate ETH2220) GN=gag-pol PE=3 SV=3 826 1059 3.0E-07
sp|P18042|POL_HV2G1 Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate Ghana-1) GN=gag-pol PE=1 SV=4 806 998 3.0E-07
sp|P05959|POL_HV1RH Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate RF/HAT3) GN=gag-pol PE=1 SV=3 827 1022 3.0E-07
sp|P20875|POL_HV1JR Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate JRCSF) GN=gag-pol PE=1 SV=3 827 1078 3.0E-07
sp|P04026|POL_IPHA Putative Pol polyprotein OS=Hamster intracisternal a-particle H18 GN=pol PE=3 SV=1 828 1117 3.0E-07
sp|Q73368|POL_HV1B9 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (strain 89.6) GN=gag-pol PE=3 SV=3 827 1078 3.0E-07
sp|P04589|POL_HV1EL Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype D (isolate ELI) GN=gag-pol PE=3 SV=3 828 1031 4.0E-07
sp|P20876|POL_HV2ST Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate ST) GN=gag-pol PE=3 SV=3 812 971 4.0E-07
sp|Q9QC07|POK18_HUMAN Endogenous retrovirus group K member 18 Pol protein OS=Homo sapiens GN=ERVK-18 PE=3 SV=2 806 972 5.0E-07
sp|P63133|POK8_HUMAN Endogenous retrovirus group K member 8 Pol protein OS=Homo sapiens GN=ERVK-8 PE=3 SV=1 806 972 5.0E-07
sp|Q66H30|GIN1_RAT Gypsy retrotransposon integrase-like protein 1 OS=Rattus norvegicus GN=GIN1 PE=2 SV=1 1335 1525 5.0E-07
sp|Q79666|POL_HV1MV Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group O (isolate MVP5180) GN=gag-pol PE=3 SV=3 826 1049 7.0E-07
sp|P04584|POL_HV2RO Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate ROD) GN=gag-pol PE=1 SV=3 812 971 8.0E-07
sp|Q76634|POL_HV2UC Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype B (isolate UC1) GN=gag-pol PE=3 SV=3 806 1058 8.0E-07
sp|P12497|POL_HV1N5 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate NY5) GN=gag-pol PE=1 SV=4 827 1078 8.0E-07
sp|P05962|POL_HV2NZ Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate NIH-Z) GN=gag-pol PE=3 SV=3 822 995 8.0E-07
sp|Q89928|POL_HV2EH Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype B (isolate EHO) GN=gag-pol PE=3 SV=3 806 1063 9.0E-07
sp|Q77373|POL_HV1AN Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group O (isolate ANT70) GN=gag-pol PE=3 SV=3 826 1016 9.0E-07
sp|P12451|POL_HV2SB Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate SBLISY) GN=gag-pol PE=3 SV=3 811 998 1.0E-06
sp|Q8AII1|POL_SIVTN Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate TAN1) GN=gag-pol PE=3 SV=4 826 997 1.0E-06
sp|A4FUB7|GIN1_BOVIN Gypsy retrotransposon integrase-like protein 1 OS=Bos taurus GN=GIN1 PE=2 SV=1 1330 1525 1.0E-06
sp|P63136|POK25_HUMAN Endogenous retrovirus group K member 25 Pol protein OS=Homo sapiens GN=ERVK-25 PE=3 SV=1 806 972 2.0E-06
sp|Q9QBZ1|POL_HV1M2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype F2 (isolate MP257) GN=gag-pol PE=3 SV=3 827 1057 2.0E-06
sp|Q9UQG0|POK11_HUMAN Endogenous retrovirus group K member 11 Pol protein OS=Homo sapiens GN=ERVK-11 PE=2 SV=2 806 972 2.0E-06
sp|P63132|PO113_HUMAN Endogenous retrovirus group K member 113 Pol protein OS=Homo sapiens GN=HERVK_113 PE=3 SV=1 806 972 3.0E-06
sp|P63135|POK7_HUMAN Endogenous retrovirus group K member 7 Pol protein OS=Homo sapiens GN=ERVK-7 PE=3 SV=1 806 972 3.0E-06
sp|P15833|POL_HV2D2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype B (isolate D205) GN=gag-pol PE=3 SV=3 806 1063 3.0E-06
sp|Q7M732|RTL1_MOUSE Retrotransposon-like protein 1 OS=Mus musculus GN=Rtl1 PE=2 SV=1 924 1212 3.0E-06
sp|Q02836|POL_SIVG1 Gag-Pol polyprotein OS=Simian immunodeficiency virus agm.grivet (isolate AGM gr-1) GN=gag-pol PE=3 SV=2 826 984 4.0E-06
sp|Q8K259|GIN1_MOUSE Gypsy retrotransposon integrase-like protein 1 OS=Mus musculus GN=Gin1 PE=2 SV=2 1335 1562 6.0E-06
sp|P10266|POK10_HUMAN Endogenous retrovirus group K member 10 Pol protein OS=Homo sapiens GN=ERVK-10 PE=3 SV=2 806 972 8.0E-06
sp|Q5RBK0|GIN1_PONAB Gypsy retrotransposon integrase-like protein 1 OS=Pongo abelii GN=GIN1 PE=2 SV=1 1307 1525 1.0E-05
sp|Q9WJR5|POK19_HUMAN Endogenous retrovirus group K member 19 Pol protein OS=Homo sapiens GN=ERVK-19 PE=2 SV=2 806 967 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|589900
MDHSQGYDSSAYIPYEDQDSRVFVGNGLVPPVLTPGVYSIRSHLNLNRANERFFENKEIPEDHKVRRVLRQQNHP
DIASYTEVHRDALLLLPYAAYMKRISDVFLPPHWEDDYRFTLTQRQGDMAFSAWTTSLKTTNNCLTGSPNHYSDD
DLRRHFRVAMNETLRDRYLEYCKNVDLELVTNLDEWIRQVNLLAIPLERRRQVDGANWGRNMAAAGNTPSSGSGG
SLLNRVTPRHLPGPTSYQSSPYQSRAASQSVNRFSAPSSAMATSGSYPSSGSTMSRPANSRSYPPLMSIYNALPS
HLARPPPLTDNWKRYLLRNKGCFRCRKIFVHHLSSDCDMERNINPRNWSRMLSDDECAPLLRAWQDRRRENQRVA
AVVAEPEIVTSSIEDLEAEFAAAQQDEEKVGDSYLDGSTDSNTDVVISPVWDTDDTDLWSNSDHPNQFVGAVMYS
STLSPVSPSLRSSIVEGEIEDFYGPDEDSYLFAAVTEKDVEDFDPDAVLLDEEYVSNPSIPPPRDHLLWTCHLLG
PASHARVQALIDHGCPTVLISSHLVHALDLRLIPLESPLSLGGVGGGKFACSHFVKLRIRSLDNSWTAQHTRALV
VPNIPFDIILGLEWLKANKIVVDMSNRSVLAKSSGYHLLRVGSVPEIRRSSYVPSITSTVLRRGLSNAPARHNFD
ARRQLVDRSRRLLRRVLVQLQRTTPRLQPIPDALLCFSVIRSRISILAAAMSRSCAFQRAEDDVKSAFNDVFLDV
PVNAVPPKPFLHTDGTLRVADSTVKSEFSDLFPERLPHVDTLPHNICHRIVVTAVEKICTSREYTCPRKWREDWK
KQIEEHLRAGRIRPSSSPFASPSFLVPKADSSASPRWVIDYRRLNAVTIPDRFPLPRIDDILADCAKGKIWAKID
MTSAFFQTRMHPDNIKYTACRTPFGLYEWNVMPMGLRNSPSTQQRRVTNALRHLIGDVCHVYLDDIVIWSDTLEQ
HAINVRKVLEALRNDKLFCSLKKSHLFCDDILFLGHKISRDGIEADPSKVDKILAWPRPRNATEVRRFLGLVRFV
GHYLPNLSAHTHILYHLTTKEADKCFPVWSPKHQTAFDAIKELVTSRISFTCDASNSGTGAILSWGPSWKDSRPV
AFDSQHYSSAQRHYPTHEQELLAVIRSLKKWRSDLLGMHVEIYTDHKTLLNFDTQKDLSRRQARWMEFLSQYDYN
FNYIAGTLNTAADALSRMPPDLPVEDPTLMVASTFLSLSASVLAGPASYSESEKTTTAHRLKLDLSNTLLRDIRN
GYASDRFVLKLKDAMKHGSNVHPGFQETDGLLFYDGRIVIPNVASLRERLFYLAHDQLGHFGVDKSYDNLRSSFY
WPNMRRDLEKAYVPSCESCQMNKSTTSLRSGPLHPLPIPDERFASIAIDFIGPLPLEHGFDFLATITDRLGADIK
LIPCKSSTTAEDFAQLFLDNWVCDNGCPREIVSDRDSRFLSKFWQTLTSLLGINHITSSAFHPQTDGSSERTNKT
VIQCLRFFVDRNQKGWVNALPRVRFNIMSSINASTRFSGFQLKTGFSPRLFPVPPPLDSSSTDEVRSATLLLNKL
RTDVFEAKDNLLAAKVVQAYYANDYRADDPGFKVGDRVLLNTTNRRREYMHKGSGRAAKFMPRFDGPFQIVKAHP
ESSSYTLSLPPSATFHPTFHVSQLRRFIPNDDTAFPSRKPCNPEPTLVDGDWEHVIERIIDERQRGRGKQYLVRW
KGFSSAHDEWIPHRLLRDNVALDEWETRPPDVPTEE*
Coding >Agabi119p4|589900
ATGGATCACTCCCAAGGCTATGATTCCTCTGCCTACATCCCTTATGAAGACCAGGATTCACGAGTCTTTGTCGGC
AATGGATTGGTTCCCCCCGTCCTCACACCTGGAGTCTATAGTATTCGTTCCCATCTTAATTTGAACCGAGCCAAT
GAACGTTTCTTTGAGAATAAAGAAATACCCGAAGATCACAAAGTACGTCGGGTGCTTCGACAACAGAATCACCCC
GATATTGCATCTTACACCGAGGTTCATCGTGACGCCTTGCTTCTCCTTCCTTATGCCGCTTATATGAAAAGGATC
AGTGACGTTTTCCTTCCCCCCCACTGGGAGGACGACTACAGGTTTACGCTCACGCAGCGTCAGGGCGATATGGCT
TTCTCTGCCTGGACTACCTCTCTCAAAACGACCAATAATTGCCTCACCGGGTCTCCTAACCATTATTCCGATGAC
GACTTGCGTCGACACTTTCGTGTCGCTATGAATGAGACCCTCCGAGATCGGTACTTGGAGTACTGCAAGAATGTT
GATCTGGAACTGGTTACCAATCTGGATGAATGGATTCGCCAAGTAAATTTACTCGCCATCCCCCTTGAACGTCGC
CGCCAAGTCGATGGTGCCAATTGGGGTAGGAACATGGCTGCTGCTGGAAATACTCCGTCATCCGGTTCTGGGGGC
TCGCTTCTGAATCGTGTCACTCCACGTCACCTGCCGGGTCCTACCTCTTATCAGTCTTCACCTTATCAGTCTCGC
GCCGCTTCTCAGTCTGTCAATCGCTTTTCGGCCCCATCTTCTGCTATGGCTACTTCTGGTTCTTACCCTTCTTCG
GGCTCCACGATGTCACGTCCTGCCAATTCTCGCTCTTATCCTCCGCTCATGAGTATCTACAATGCTCTTCCATCT
CATCTTGCTCGACCTCCTCCTCTCACAGATAATTGGAAACGGTATCTCTTGCGTAACAAGGGATGTTTCCGCTGT
CGGAAGATATTCGTTCATCACCTCTCAAGTGATTGTGATATGGAGCGCAACATCAATCCTCGTAACTGGTCACGT
ATGCTCTCTGATGATGAATGTGCTCCACTTCTACGTGCCTGGCAAGATCGCCGTCGTGAGAATCAGCGTGTCGCT
GCCGTGGTAGCAGAGCCTGAAATTGTTACTTCTTCTATTGAAGACCTCGAGGCTGAATTCGCTGCTGCTCAACAG
GATGAAGAAAAAGTCGGAGATTCGTATCTGGATGGCTCAACAGACTCTAATACAGATGTTGTTATTAGCCCCGTC
TGGGACACAGATGACACCGACTTGTGGTCTAACTCTGATCATCCGAATCAATTTGTCGGCGCTGTCATGTACTCT
TCTACCCTATCGCCCGTCTCCCCCTCCCTTCGTTCTTCAATCGTGGAAGGTGAAATTGAGGATTTCTATGGCCCG
GATGAAGATTCTTACCTCTTTGCTGCGGTTACTGAAAAGGATGTTGAAGATTTTGATCCGGATGCCGTCTTGTTA
GATGAAGAGTACGTCTCCAACCCTTCCATTCCCCCCCCTCGCGATCACCTTCTCTGGACATGTCACCTCCTTGGC
CCTGCCAGTCATGCCCGTGTCCAGGCACTCATTGACCACGGTTGTCCAACAGTATTGATATCTTCACACCTCGTT
CACGCACTTGACTTGCGTCTCATCCCGTTGGAAAGTCCGTTGTCATTGGGAGGAGTTGGAGGTGGAAAATTTGCA
TGTTCTCATTTCGTTAAGCTTCGCATCCGTTCGCTTGATAATTCTTGGACCGCACAACACACTCGTGCGCTTGTT
GTACCGAATATCCCTTTTGATATCATTCTTGGCCTTGAATGGCTCAAAGCCAATAAAATTGTCGTTGACATGTCC
AATAGATCAGTTCTGGCTAAGAGTTCTGGTTATCATCTTCTTCGTGTTGGCTCTGTTCCTGAGATTCGTCGTTCG
TCATATGTACCTTCCATTACTAGCACTGTTCTTCGCCGTGGACTTTCAAATGCCCCGGCTCGTCACAACTTCGAT
GCACGCCGACAACTAGTAGATCGATCTCGTCGACTTCTCCGTCGTGTGCTTGTGCAATTGCAAAGGACTACCCCT
CGGTTACAACCCATTCCGGATGCTCTTCTCTGCTTCTCTGTGATACGCAGCCGTATCTCCATTCTTGCAGCTGCC
ATGTCCCGTTCCTGTGCTTTTCAACGTGCCGAAGACGACGTGAAGTCTGCCTTTAATGATGTTTTCCTTGACGTC
CCTGTGAATGCAGTCCCTCCGAAGCCTTTCCTGCACACAGACGGCACCTTGCGTGTCGCTGACTCCACTGTGAAG
TCGGAGTTCTCTGATCTCTTCCCTGAACGCCTGCCTCACGTTGACACGCTGCCTCATAACATCTGCCACCGTATT
GTGGTTACAGCAGTTGAGAAGATCTGTACCTCGCGTGAATATACTTGTCCTCGGAAATGGCGTGAAGACTGGAAG
AAGCAGATTGAGGAACATCTCCGTGCTGGCCGTATCCGACCTTCTTCTTCTCCTTTTGCATCTCCGTCCTTCCTT
GTTCCAAAAGCTGACTCTTCTGCCTCTCCGCGCTGGGTGATTGATTATCGAAGGCTCAACGCTGTGACCATACCG
GATAGGTTCCCATTGCCTCGAATTGATGATATTTTGGCCGATTGTGCAAAAGGAAAGATATGGGCTAAGATTGAT
ATGACCAGTGCCTTCTTTCAGACGAGGATGCACCCTGACAACATCAAATACACAGCGTGTCGTACTCCATTTGGC
CTTTACGAATGGAATGTTATGCCAATGGGTCTTCGCAATTCTCCCTCTACACAGCAACGTCGTGTCACGAATGCA
CTTCGGCACCTCATTGGAGACGTCTGTCATGTTTACCTCGATGACATTGTCATTTGGTCTGATACTCTGGAACAA
CACGCTATCAATGTTCGCAAAGTCCTTGAAGCTCTTCGTAATGACAAGCTCTTCTGTTCTCTGAAGAAATCACAT
CTGTTCTGCGACGACATTCTCTTCCTCGGGCACAAGATCTCCCGAGATGGGATAGAAGCTGACCCATCAAAAGTT
GATAAAATCTTGGCTTGGCCTCGTCCTCGTAACGCAACCGAAGTCCGCCGCTTCTTAGGTCTTGTTCGTTTCGTT
GGCCATTATCTTCCAAACTTATCAGCGCACACACACATCCTCTATCATTTGACAACAAAAGAGGCTGATAAGTGT
TTTCCGGTTTGGTCTCCTAAACATCAGACTGCCTTCGATGCCATCAAAGAACTTGTAACTAGCCGGATTTCCTTT
ACTTGCGATGCAAGTAATTCGGGTACGGGTGCCATCCTCAGCTGGGGACCTTCATGGAAAGACTCCCGACCAGTC
GCCTTCGACTCGCAACACTATTCCTCTGCTCAACGTCATTACCCTACACATGAGCAGGAGCTTCTGGCTGTCATC
CGATCTCTTAAAAAGTGGCGTTCGGATCTCCTTGGCATGCATGTTGAGATCTATACTGACCACAAAACGCTGCTC
AATTTTGATACTCAGAAAGACCTTTCTCGACGTCAAGCGAGATGGATGGAATTTCTCTCTCAATATGACTACAAC
TTCAACTACATTGCTGGTACACTCAATACGGCTGCAGACGCACTCTCAAGAATGCCTCCCGACCTTCCTGTTGAG
GATCCTACATTAATGGTTGCGTCAACTTTTCTATCCCTTTCTGCTTCCGTCCTTGCCGGTCCGGCTTCATATTCT
GAGTCTGAGAAGACCACGACTGCGCATCGCCTCAAGTTAGACCTTAGCAACACGCTACTTCGTGACATCCGGAAT
GGTTACGCTTCCGACCGCTTCGTCCTAAAGCTGAAAGACGCTATGAAGCACGGTTCCAATGTACACCCTGGATTC
CAGGAGACGGATGGGTTGCTCTTTTATGACGGCCGTATAGTCATTCCGAACGTTGCATCGTTACGCGAACGGTTA
TTCTACCTTGCCCATGATCAGCTTGGACATTTTGGTGTCGACAAATCGTATGATAACCTCCGGTCTTCCTTTTAC
TGGCCCAACATGCGTCGCGATCTCGAAAAAGCATATGTTCCAAGTTGTGAGAGCTGTCAGATGAACAAATCGACA
ACTTCACTCCGTTCTGGTCCTCTTCACCCGTTGCCAATTCCTGATGAACGTTTTGCGTCTATTGCAATTGACTTC
ATCGGACCTTTACCACTCGAACATGGCTTTGACTTCCTCGCAACCATTACCGACCGTCTCGGTGCTGATATCAAA
CTCATACCTTGCAAGTCTTCCACTACAGCTGAAGATTTCGCGCAGTTGTTCCTTGATAACTGGGTTTGTGACAAC
GGATGCCCTAGAGAAATTGTTTCCGATCGGGATAGTCGTTTTCTCTCTAAATTTTGGCAAACTTTGACTTCGCTC
CTTGGAATCAATCATATCACGTCCTCTGCTTTTCATCCACAGACCGACGGTTCTTCCGAACGAACAAACAAGACG
GTTATCCAATGCCTCCGCTTTTTTGTGGATAGAAATCAAAAAGGATGGGTTAACGCGCTACCCCGCGTTCGTTTC
AACATCATGTCTTCCATCAATGCGTCAACTCGGTTCTCGGGGTTTCAGCTAAAGACAGGGTTCTCTCCTAGGCTT
TTTCCCGTACCCCCTCCACTTGACTCTTCTTCGACTGACGAGGTCCGTTCGGCCACCTTACTGCTTAATAAGCTC
AGAACGGATGTTTTCGAAGCCAAGGATAATCTCCTCGCTGCTAAAGTTGTTCAGGCTTATTACGCTAATGACTAC
CGTGCGGACGACCCTGGTTTCAAAGTTGGCGATCGTGTACTGTTGAACACTACGAACCGTAGAAGGGAGTACATG
CATAAGGGCAGTGGCCGAGCAGCCAAATTCATGCCACGTTTCGATGGACCCTTCCAGATTGTGAAGGCTCACCCG
GAATCGTCATCATACACTCTTTCTCTCCCCCCTTCTGCCACCTTCCACCCCACCTTCCACGTTTCGCAGCTCCGC
CGCTTCATCCCTAATGACGATACCGCCTTTCCATCCCGCAAACCCTGCAACCCAGAACCTACTCTTGTCGACGGA
GACTGGGAACATGTGATAGAGCGAATCATTGACGAACGCCAGCGAGGGCGAGGTAAACAATATCTCGTCCGTTGG
AAAGGTTTTAGTTCAGCCCATGATGAGTGGATTCCCCACAGGCTTCTACGAGACAATGTTGCTCTTGATGAATGG
GAAACACGCCCTCCAGACGTGCCTACGGAGGAATAA
Transcript >Agabi119p4|589900
ATGGATCACTCCCAAGGCTATGATTCCTCTGCCTACATCCCTTATGAAGACCAGGATTCACGAGTCTTTGTCGGC
AATGGATTGGTTCCCCCCGTCCTCACACCTGGAGTCTATAGTATTCGTTCCCATCTTAATTTGAACCGAGCCAAT
GAACGTTTCTTTGAGAATAAAGAAATACCCGAAGATCACAAAGTACGTCGGGTGCTTCGACAACAGAATCACCCC
GATATTGCATCTTACACCGAGGTTCATCGTGACGCCTTGCTTCTCCTTCCTTATGCCGCTTATATGAAAAGGATC
AGTGACGTTTTCCTTCCCCCCCACTGGGAGGACGACTACAGGTTTACGCTCACGCAGCGTCAGGGCGATATGGCT
TTCTCTGCCTGGACTACCTCTCTCAAAACGACCAATAATTGCCTCACCGGGTCTCCTAACCATTATTCCGATGAC
GACTTGCGTCGACACTTTCGTGTCGCTATGAATGAGACCCTCCGAGATCGGTACTTGGAGTACTGCAAGAATGTT
GATCTGGAACTGGTTACCAATCTGGATGAATGGATTCGCCAAGTAAATTTACTCGCCATCCCCCTTGAACGTCGC
CGCCAAGTCGATGGTGCCAATTGGGGTAGGAACATGGCTGCTGCTGGAAATACTCCGTCATCCGGTTCTGGGGGC
TCGCTTCTGAATCGTGTCACTCCACGTCACCTGCCGGGTCCTACCTCTTATCAGTCTTCACCTTATCAGTCTCGC
GCCGCTTCTCAGTCTGTCAATCGCTTTTCGGCCCCATCTTCTGCTATGGCTACTTCTGGTTCTTACCCTTCTTCG
GGCTCCACGATGTCACGTCCTGCCAATTCTCGCTCTTATCCTCCGCTCATGAGTATCTACAATGCTCTTCCATCT
CATCTTGCTCGACCTCCTCCTCTCACAGATAATTGGAAACGGTATCTCTTGCGTAACAAGGGATGTTTCCGCTGT
CGGAAGATATTCGTTCATCACCTCTCAAGTGATTGTGATATGGAGCGCAACATCAATCCTCGTAACTGGTCACGT
ATGCTCTCTGATGATGAATGTGCTCCACTTCTACGTGCCTGGCAAGATCGCCGTCGTGAGAATCAGCGTGTCGCT
GCCGTGGTAGCAGAGCCTGAAATTGTTACTTCTTCTATTGAAGACCTCGAGGCTGAATTCGCTGCTGCTCAACAG
GATGAAGAAAAAGTCGGAGATTCGTATCTGGATGGCTCAACAGACTCTAATACAGATGTTGTTATTAGCCCCGTC
TGGGACACAGATGACACCGACTTGTGGTCTAACTCTGATCATCCGAATCAATTTGTCGGCGCTGTCATGTACTCT
TCTACCCTATCGCCCGTCTCCCCCTCCCTTCGTTCTTCAATCGTGGAAGGTGAAATTGAGGATTTCTATGGCCCG
GATGAAGATTCTTACCTCTTTGCTGCGGTTACTGAAAAGGATGTTGAAGATTTTGATCCGGATGCCGTCTTGTTA
GATGAAGAGTACGTCTCCAACCCTTCCATTCCCCCCCCTCGCGATCACCTTCTCTGGACATGTCACCTCCTTGGC
CCTGCCAGTCATGCCCGTGTCCAGGCACTCATTGACCACGGTTGTCCAACAGTATTGATATCTTCACACCTCGTT
CACGCACTTGACTTGCGTCTCATCCCGTTGGAAAGTCCGTTGTCATTGGGAGGAGTTGGAGGTGGAAAATTTGCA
TGTTCTCATTTCGTTAAGCTTCGCATCCGTTCGCTTGATAATTCTTGGACCGCACAACACACTCGTGCGCTTGTT
GTACCGAATATCCCTTTTGATATCATTCTTGGCCTTGAATGGCTCAAAGCCAATAAAATTGTCGTTGACATGTCC
AATAGATCAGTTCTGGCTAAGAGTTCTGGTTATCATCTTCTTCGTGTTGGCTCTGTTCCTGAGATTCGTCGTTCG
TCATATGTACCTTCCATTACTAGCACTGTTCTTCGCCGTGGACTTTCAAATGCCCCGGCTCGTCACAACTTCGAT
GCACGCCGACAACTAGTAGATCGATCTCGTCGACTTCTCCGTCGTGTGCTTGTGCAATTGCAAAGGACTACCCCT
CGGTTACAACCCATTCCGGATGCTCTTCTCTGCTTCTCTGTGATACGCAGCCGTATCTCCATTCTTGCAGCTGCC
ATGTCCCGTTCCTGTGCTTTTCAACGTGCCGAAGACGACGTGAAGTCTGCCTTTAATGATGTTTTCCTTGACGTC
CCTGTGAATGCAGTCCCTCCGAAGCCTTTCCTGCACACAGACGGCACCTTGCGTGTCGCTGACTCCACTGTGAAG
TCGGAGTTCTCTGATCTCTTCCCTGAACGCCTGCCTCACGTTGACACGCTGCCTCATAACATCTGCCACCGTATT
GTGGTTACAGCAGTTGAGAAGATCTGTACCTCGCGTGAATATACTTGTCCTCGGAAATGGCGTGAAGACTGGAAG
AAGCAGATTGAGGAACATCTCCGTGCTGGCCGTATCCGACCTTCTTCTTCTCCTTTTGCATCTCCGTCCTTCCTT
GTTCCAAAAGCTGACTCTTCTGCCTCTCCGCGCTGGGTGATTGATTATCGAAGGCTCAACGCTGTGACCATACCG
GATAGGTTCCCATTGCCTCGAATTGATGATATTTTGGCCGATTGTGCAAAAGGAAAGATATGGGCTAAGATTGAT
ATGACCAGTGCCTTCTTTCAGACGAGGATGCACCCTGACAACATCAAATACACAGCGTGTCGTACTCCATTTGGC
CTTTACGAATGGAATGTTATGCCAATGGGTCTTCGCAATTCTCCCTCTACACAGCAACGTCGTGTCACGAATGCA
CTTCGGCACCTCATTGGAGACGTCTGTCATGTTTACCTCGATGACATTGTCATTTGGTCTGATACTCTGGAACAA
CACGCTATCAATGTTCGCAAAGTCCTTGAAGCTCTTCGTAATGACAAGCTCTTCTGTTCTCTGAAGAAATCACAT
CTGTTCTGCGACGACATTCTCTTCCTCGGGCACAAGATCTCCCGAGATGGGATAGAAGCTGACCCATCAAAAGTT
GATAAAATCTTGGCTTGGCCTCGTCCTCGTAACGCAACCGAAGTCCGCCGCTTCTTAGGTCTTGTTCGTTTCGTT
GGCCATTATCTTCCAAACTTATCAGCGCACACACACATCCTCTATCATTTGACAACAAAAGAGGCTGATAAGTGT
TTTCCGGTTTGGTCTCCTAAACATCAGACTGCCTTCGATGCCATCAAAGAACTTGTAACTAGCCGGATTTCCTTT
ACTTGCGATGCAAGTAATTCGGGTACGGGTGCCATCCTCAGCTGGGGACCTTCATGGAAAGACTCCCGACCAGTC
GCCTTCGACTCGCAACACTATTCCTCTGCTCAACGTCATTACCCTACACATGAGCAGGAGCTTCTGGCTGTCATC
CGATCTCTTAAAAAGTGGCGTTCGGATCTCCTTGGCATGCATGTTGAGATCTATACTGACCACAAAACGCTGCTC
AATTTTGATACTCAGAAAGACCTTTCTCGACGTCAAGCGAGATGGATGGAATTTCTCTCTCAATATGACTACAAC
TTCAACTACATTGCTGGTACACTCAATACGGCTGCAGACGCACTCTCAAGAATGCCTCCCGACCTTCCTGTTGAG
GATCCTACATTAATGGTTGCGTCAACTTTTCTATCCCTTTCTGCTTCCGTCCTTGCCGGTCCGGCTTCATATTCT
GAGTCTGAGAAGACCACGACTGCGCATCGCCTCAAGTTAGACCTTAGCAACACGCTACTTCGTGACATCCGGAAT
GGTTACGCTTCCGACCGCTTCGTCCTAAAGCTGAAAGACGCTATGAAGCACGGTTCCAATGTACACCCTGGATTC
CAGGAGACGGATGGGTTGCTCTTTTATGACGGCCGTATAGTCATTCCGAACGTTGCATCGTTACGCGAACGGTTA
TTCTACCTTGCCCATGATCAGCTTGGACATTTTGGTGTCGACAAATCGTATGATAACCTCCGGTCTTCCTTTTAC
TGGCCCAACATGCGTCGCGATCTCGAAAAAGCATATGTTCCAAGTTGTGAGAGCTGTCAGATGAACAAATCGACA
ACTTCACTCCGTTCTGGTCCTCTTCACCCGTTGCCAATTCCTGATGAACGTTTTGCGTCTATTGCAATTGACTTC
ATCGGACCTTTACCACTCGAACATGGCTTTGACTTCCTCGCAACCATTACCGACCGTCTCGGTGCTGATATCAAA
CTCATACCTTGCAAGTCTTCCACTACAGCTGAAGATTTCGCGCAGTTGTTCCTTGATAACTGGGTTTGTGACAAC
GGATGCCCTAGAGAAATTGTTTCCGATCGGGATAGTCGTTTTCTCTCTAAATTTTGGCAAACTTTGACTTCGCTC
CTTGGAATCAATCATATCACGTCCTCTGCTTTTCATCCACAGACCGACGGTTCTTCCGAACGAACAAACAAGACG
GTTATCCAATGCCTCCGCTTTTTTGTGGATAGAAATCAAAAAGGATGGGTTAACGCGCTACCCCGCGTTCGTTTC
AACATCATGTCTTCCATCAATGCGTCAACTCGGTTCTCGGGGTTTCAGCTAAAGACAGGGTTCTCTCCTAGGCTT
TTTCCCGTACCCCCTCCACTTGACTCTTCTTCGACTGACGAGGTCCGTTCGGCCACCTTACTGCTTAATAAGCTC
AGAACGGATGTTTTCGAAGCCAAGGATAATCTCCTCGCTGCTAAAGTTGTTCAGGCTTATTACGCTAATGACTAC
CGTGCGGACGACCCTGGTTTCAAAGTTGGCGATCGTGTACTGTTGAACACTACGAACCGTAGAAGGGAGTACATG
CATAAGGGCAGTGGCCGAGCAGCCAAATTCATGCCACGTTTCGATGGACCCTTCCAGATTGTGAAGGCTCACCCG
GAATCGTCATCATACACTCTTTCTCTCCCCCCTTCTGCCACCTTCCACCCCACCTTCCACGTTTCGCAGCTCCGC
CGCTTCATCCCTAATGACGATACCGCCTTTCCATCCCGCAAACCCTGCAACCCAGAACCTACTCTTGTCGACGGA
GACTGGGAACATGTGATAGAGCGAATCATTGACGAACGCCAGCGAGGGCGAGGTAAACAATATCTCGTCCGTTGG
AAAGGTTTTAGTTCAGCCCATGATGAGTGGATTCCCCACAGGCTTCTACGAGACAATGTTGCTCTTGATGAATGG
GAAACACGCCCTCCAGACGTGCCTACGGAGGAATAA
Gene >Agabi119p4|589900
ATGGATCACTCCCAAGGCTATGATTCCTCTGCCTACATCCCTTATGAAGACCAGGATTCACGAGTCTTTGTCGGC
AATGGATTGGTTCCCCCCGTCCTCACACCTGGAGTCTATAGTATTCGTTCCCATCTTAATTTGAACCGAGCCAAT
GAACGTTTCTTTGAGAATAAAGAAATACCCGAAGATCACAAAGTACGTCGGGTGCTTCGACAACAGAATCACCCC
GATATTGCATCTTACACCGAGGTTCATCGTGACGCCTTGCTTCTCCTTCCTTATGCCGCTTATATGAAAAGGATC
AGTGACGTTTTCCTTCCCCCCCACTGGGAGGACGACTACAGGTTTACGCTCACGCAGCGTCAGGGCGATATGGCT
TTCTCTGCCTGGACTACCTCTCTCAAAACGACCAATAATTGCCTCACCGGGTCTCCTAACCATTATTCCGATGAC
GACTTGCGTCGACACTTTCGTGTCGCTATGAATGAGACCCTCCGAGATCGGTACTTGGAGTACTGCAAGAATGTT
GATCTGGAACTGGTTACCAATCTGGATGAATGGATTCGCCAAGTAAATTTACTCGCCATCCCCCTTGAACGTCGC
CGCCAAGTCGATGGTGCCAATTGGGGTAGGAACATGGCTGCTGCTGGAAATACTCCGTCATCCGGTTCTGGGGGC
TCGCTTCTGAATCGTGTCACTCCACGTCACCTGCCGGGTCCTACCTCTTATCAGTCTTCACCTTATCAGTCTCGC
GCCGCTTCTCAGTCTGTCAATCGCTTTTCGGCCCCATCTTCTGCTATGGCTACTTCTGGTTCTTACCCTTCTTCG
GGCTCCACGATGTCACGTCCTGCCAATTCTCGCTCTTATCCTCCGCTCATGAGTATCTACAATGCTCTTCCATCT
CATCTTGCTCGACCTCCTCCTCTCACAGATAATTGGAAACGGTATCTCTTGCGTAACAAGGGATGTTTCCGCTGT
CGGAAGATATTCGTTCATCACCTCTCAAGTGATTGTGATATGGAGCGCAACATCAATCCTCGTAACTGGTCACGT
ATGCTCTCTGATGATGAATGTGCTCCACTTCTACGTGCCTGGCAAGATCGCCGTCGTGAGAATCAGCGTGTCGCT
GCCGTGGTAGCAGAGCCTGAAATTGTTACTTCTTCTATTGAAGACCTCGAGGCTGAATTCGCTGCTGCTCAACAG
GATGAAGAAAAAGTCGGAGATTCGTATCTGGATGGCTCAACAGACTCTAATACAGATGTTGTTATTAGCCCCGTC
TGGGACACAGATGACACCGACTTGTGGTCTAACTCTGATCATCCGAATCAATTTGTCGGCGCTGTCATGTACTCT
TCTACCCTATCGCCCGTCTCCCCCTCCCTTCGTTCTTCAATCGTGGAAGGTGAAATTGAGGATTTCTATGGCCCG
GATGAAGATTCTTACCTCTTTGCTGCGGTTACTGAAAAGGATGTTGAAGATTTTGATCCGGATGCCGTCTTGTTA
GATGAAGAGTACGTCTCCAACCCTTCCATTCCCCCCCCTCGCGATCACCTTCTCTGGACATGTCACCTCCTTGGC
CCTGCCAGTCATGCCCGTGTCCAGGCACTCATTGACCACGGTTGTCCAACAGTATTGATATCTTCACACCTCGTT
CACGCACTTGACTTGCGTCTCATCCCGTTGGAAAGTCCGTTGTCATTGGGAGGAGTTGGAGGTGGAAAATTTGCA
TGTTCTCATTTCGTTAAGCTTCGCATCCGTTCGCTTGATAATTCTTGGACCGCACAACACACTCGTGCGCTTGTT
GTACCGAATATCCCTTTTGATATCATTCTTGGCCTTGAATGGCTCAAAGCCAATAAAATTGTCGTTGACATGTCC
AATAGATCAGTTCTGGCTAAGAGTTCTGGTTATCATCTTCTTCGTGTTGGCTCTGTTCCTGAGATTCGTCGTTCG
TCATATGTACCTTCCATTACTAGCACTGTTCTTCGCCGTGGACTTTCAAATGCCCCGGCTCGTCACAACTTCGAT
GCACGCCGACAACTAGTAGATCGATCTCGTCGACTTCTCCGTCGTGTGCTTGTGCAATTGCAAAGGACTACCCCT
CGGTTACAACCCATTCCGGATGCTCTTCTCTGCTTCTCTGTGATACGCAGCCGTATCTCCATTCTTGCAGCTGCC
ATGTCCCGTTCCTGTGCTTTTCAACGTGCCGAAGACGACGTGAAGTCTGCCTTTAATGATGTTTTCCTTGACGTC
CCTGTGAATGCAGTCCCTCCGAAGCCTTTCCTGCACACAGACGGCACCTTGCGTGTCGCTGACTCCACTGTGAAG
TCGGAGTTCTCTGATCTCTTCCCTGAACGCCTGCCTCACGTTGACACGCTGCCTCATAACATCTGCCACCGTATT
GTGGTTACAGCAGTTGAGAAGATCTGTACCTCGCGTGAATATACTTGTCCTCGGAAATGGCGTGAAGACTGGAAG
AAGCAGATTGAGGAACATCTCCGTGCTGGCCGTATCCGACCTTCTTCTTCTCCTTTTGCATCTCCGTCCTTCCTT
GTTCCAAAAGCTGACTCTTCTGCCTCTCCGCGCTGGGTGATTGATTATCGAAGGCTCAACGCTGTGACCATACCG
GATAGGTTCCCATTGCCTCGAATTGATGATATTTTGGCCGATTGTGCAAAAGGAAAGATATGGGCTAAGATTGAT
ATGACCAGTGCCTTCTTTCAGACGAGGATGCACCCTGACAACATCAAATACACAGCGTGTCGTACTCCATTTGGC
CTTTACGAATGGAATGTTATGCCAATGGGTCTTCGCAATTCTCCCTCTACACAGCAACGTCGTGTCACGAATGCA
CTTCGGCACCTCATTGGAGACGTCTGTCATGTTTACCTCGATGACATTGTCATTTGGTCTGATACTCTGGAACAA
CACGCTATCAATGTTCGCAAAGTCCTTGAAGCTCTTCGTAATGACAAGCTCTTCTGTTCTCTGAAGAAATCACAT
CTGTTCTGCGACGACATTCTCTTCCTCGGGCACAAGATCTCCCGAGATGGGATAGAAGCTGACCCATCAAAAGTT
GATAAAATCTTGGCTTGGCCTCGTCCTCGTAACGCAACCGAAGTCCGCCGCTTCTTAGGTCTTGTTCGTTTCGTT
GGCCATTATCTTCCAAACTTATCAGCGCACACACACATCCTCTATCATTTGACAACAAAAGAGGCTGATAAGTGT
TTTCCGGTTTGGTCTCCTAAACATCAGACTGCCTTCGATGCCATCAAAGAACTTGTAACTAGCCGTAAATGCCTT
ACTACCATCGACCACGACAATCCGGGCCCTAACAGGGATTTCCTTTACTTGCGATGCAAGTAATTCGGGTACGGG
TGCCATCCTCAGCTGGGGACCTTCATGGAAAGACTCCCGACCAGTCGCCTTCGACTCGCAACACTATTCCTCTGC
TCAACGTCATTACCCTACACATGAGCAGGAGCTTCTGGCTGTCATCCGATCTCTTAAAAAGTGGCGTTCGGATCT
CCTTGGCATGCATGTTGAGATCTATACTGACCACAAAACGCTGCTCAATTTTGATACTCAGAAAGACCTTTCTCG
ACGTCAAGCGAGATGGATGGAATTTCTCTCTCAATATGACTACAACTTCAACTACATTGCTGGTACACTCAATAC
GGCTGCAGACGCACTCTCAAGAATGCCTCCCGACCTTCCTGTTGAGGATCCTACATTAATGGTTGCGTCAACTTT
TCTATCCCTTTCTGCTTCCGTCCTTGCCGGTCCGGCTTCATATTCTGAGTCTGAGAAGACCACGACTGCGCATCG
CCTCAAGTTAGACCTTAGCAACACGCTACTTCGTGACATCCGGAATGGTTACGCTTCCGACCGCTTCGTCCTAAA
GCTGAAAGACGCTATGAAGCACGGTTCCAATGTACACCCTGGATTCCAGGAGACGGATGGGTTGCTCTTTTATGA
CGGCCGTATAGTCATTCCGAACGTTGCATCGTTACGCGAACGGTTATTCTACCTTGCCCATGATCAGCTTGGACA
TTTTGGTGTCGACAAATCGTATGATAACCTCCGGTCTTCCTTTTACTGGCCCAACATGCGTCGCGATCTCGAAAA
AGCATATGTTCCAAGTTGTGAGAGCTGTCAGATGAACAAATCGACAACTTCACTCCGTTCTGGTCCTCTTCACCC
GTTGCCAATTCCTGATGAACGTTTTGCGTCTATTGCAATTGACTTCATCGGACCTTTACCACTCGAACATGGCTT
TGACTTCCTCGCAACCATTACCGACCGTCTCGGTGCTGATATCAAACTCATACCTTGCAAGTCTTCCACTACAGC
TGAAGATTTCGCGCAGTTGTTCCTTGATAACTGGGTTTGTGACAACGGATGCCCTAGAGAAATTGTTTCCGATCG
GGATAGTCGTTTTCTCTCTAAATTTTGGCAAACTTTGACTTCGCTCCTTGGAATCAATCATATCACGTCCTCTGC
TTTTCATCCACAGACCGACGGTTCTTCCGAACGAACAAACAAGACGGTTATCCAATGCCTCCGCTTTTTTGTGGA
TAGAAATCAAAAAGGATGGGTTAACGCGCTACCCCGCGTTCGTTTCAACATCATGTCTTCCATCAATGCGTCAAC
TCGGTTCTCGGGGTTTCAGCTAAAGACAGGGTTCTCTCCTAGGCTTTTTCCCGTACCCCCTCCACTTGACTCTTC
TTCGACTGACGAGGTCCGTTCGGCCACCTTACTGCTTAATAAGCTCAGAACGGATGTTTTCGAAGCCAAGGATAA
TCTCCTCGCTGCTAAAGTTGTTCAGGCTTATTACGCTAATGACTACCGTGCGGACGACCCTGGTTTCAAAGTTGG
CGATCGTGTACTGTTGAACACTACGAACCGTAGAAGGGAGTACATGCATAAGGGCAGTGGCCGAGCAGCCAAATT
CATGCCACGTTTCGATGGACCCTTCCAGATTGTGAAGGCTCACCCGGAATCGTCATCATACACTCTTTCTCTCCC
CCCTTCTGCCACCTTCCACCCCACCTTCCACGTTTCGCAGCTCCGCCGCTTCATCCCTAATGACGATACCGCCTT
TCCATCCCGCAAACCCTGCAACCCAGAACCTACTCTTGTCGACGGAGACTGGGAACATGTGATAGAGCGAATCAT
TGACGAACGCCAGCGAGGGCGAGGTAAACAATATCTCGTCCGTTGGAAAGGTTTTAGTTCAGCCCATGATGAGTG
GATTCCCCACAGGCTTCTACGAGACAATGTTGCTCTTGATGAATGGGAAACACGCCCTCCAGACGTGCCTACGGA
GGAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail