Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|589300
Gene name
Locationscaffold_02:2778547..2779588
Strand-
Gene length (bp)1041
Transcript length (bp)975
Coding sequence length (bp)975
Protein length (aa) 325

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 1.8E-09 21 150
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 1.0E-07 28 150

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8N5I4|DHRSX_HUMAN Dehydrogenase/reductase SDR family member on chromosome X OS=Homo sapiens GN=DHRSX PE=2 SV=2 14 183 4.0E-08
sp|Q8VBZ0|DHRSX_MOUSE Dehydrogenase/reductase SDR family member on chromosome X homolog OS=Mus musculus GN=Dhrsx PE=1 SV=2 5 302 8.0E-07
sp|Q92247|BLI4_NEUCR Putative oxidoreductase bli-4, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=bli-4 PE=1 SV=1 21 159 2.0E-06
sp|Q5HLD8|Y2049_STAEQ Uncharacterized oxidoreductase SERP2049 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP2049 PE=3 SV=1 21 151 3.0E-06
sp|Q8CN40|Y2036_STAES Uncharacterized oxidoreductase SE_2036 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_2036 PE=3 SV=1 21 151 3.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8N5I4|DHRSX_HUMAN Dehydrogenase/reductase SDR family member on chromosome X OS=Homo sapiens GN=DHRSX PE=2 SV=2 14 183 4.0E-08
sp|Q8VBZ0|DHRSX_MOUSE Dehydrogenase/reductase SDR family member on chromosome X homolog OS=Mus musculus GN=Dhrsx PE=1 SV=2 5 302 8.0E-07
sp|Q92247|BLI4_NEUCR Putative oxidoreductase bli-4, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=bli-4 PE=1 SV=1 21 159 2.0E-06
sp|Q5HLD8|Y2049_STAEQ Uncharacterized oxidoreductase SERP2049 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP2049 PE=3 SV=1 21 151 3.0E-06
sp|Q8CN40|Y2036_STAES Uncharacterized oxidoreductase SE_2036 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_2036 PE=3 SV=1 21 151 3.0E-06
sp|P34251|YKK7_YEAST Uncharacterized oxidoreductase YKL107W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKL107W PE=1 SV=1 24 223 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|589300
MSSLSLIRQANSSFRPRFTPVAVFVGGTNGIGRGMAEAFGRHTQGKSNIVILGRNKDAADELFSSLPSPTDKIYN
RDFIHCDATRMKNVETATKEILARYSRVNFLVLSPGTVTMRGRDETEEGLDTKLALHYYARWKFIQGLLPALNKA
SEEGESAKVFSVFSPGNGSEIDLNDLGLKTTFSAIRAGLQMPTYNDLMIEAFYDFNPAVTFIHGYPGFVRTSLFT
KKSNSTLLNLAQPFMNTLLRPILTSPEDASEYMWHAIFNSTVGVFRTGSRGENLGKKRYFGSEEAKKKLWEHTVE
ATTIRPSSDSPTMLYTHGMRMTMG*
Coding >Agabi119p4|589300
ATGTCTTCACTGTCTCTCATTCGTCAAGCCAACTCGAGTTTCAGGCCTCGATTTACGCCGGTAGCTGTGTTTGTG
GGGGGAACAAATGGAATAGGGCGTGGAATGGCTGAAGCTTTCGGACGACACACCCAAGGGAAATCGAATATCGTC
ATCCTCGGGCGTAACAAGGATGCCGCAGACGAGCTCTTCTCTTCACTTCCCTCACCAACCGACAAAATCTATAAT
CGTGATTTCATCCATTGTGATGCTACACGAATGAAGAATGTAGAAACCGCAACGAAAGAAATCCTCGCGCGATAT
TCCAGGGTCAATTTCCTCGTTTTATCACCTGGGACTGTAACAATGAGAGGTCGGGATGAGACGGAGGAAGGGCTG
GATACCAAGCTTGCACTGCATTACTATGCCCGTTGGAAGTTTATCCAGGGATTACTCCCAGCGTTAAACAAAGCC
AGTGAGGAAGGAGAAAGCGCCAAAGTCTTCTCTGTCTTTTCCCCAGGAAACGGCAGTGAAATTGATCTAAATGAT
CTTGGCCTCAAGACGACCTTTTCTGCCATCAGAGCGGGACTACAAATGCCTACGTATAATGATTTAATGATCGAG
GCCTTTTATGATTTCAATCCTGCTGTAACATTTATCCATGGCTATCCAGGATTTGTTCGCACTTCACTGTTCACT
AAAAAATCCAACTCGACACTCCTGAACCTCGCTCAACCTTTCATGAACACTTTACTCCGTCCCATATTAACTTCG
CCAGAAGATGCTAGCGAATATATGTGGCATGCTATATTCAACAGTACAGTGGGTGTCTTCAGAACGGGATCGCGG
GGTGAAAATTTGGGGAAGAAGAGATACTTTGGAAGTGAAGAGGCGAAAAAGAAGCTTTGGGAGCATACAGTTGAA
GCTACGACGATTCGTCCGTCATCTGATAGTCCGACGATGTTGTATACGCATGGAATGAGGATGACTATGGGCTGA
Transcript >Agabi119p4|589300
ATGTCTTCACTGTCTCTCATTCGTCAAGCCAACTCGAGTTTCAGGCCTCGATTTACGCCGGTAGCTGTGTTTGTG
GGGGGAACAAATGGAATAGGGCGTGGAATGGCTGAAGCTTTCGGACGACACACCCAAGGGAAATCGAATATCGTC
ATCCTCGGGCGTAACAAGGATGCCGCAGACGAGCTCTTCTCTTCACTTCCCTCACCAACCGACAAAATCTATAAT
CGTGATTTCATCCATTGTGATGCTACACGAATGAAGAATGTAGAAACCGCAACGAAAGAAATCCTCGCGCGATAT
TCCAGGGTCAATTTCCTCGTTTTATCACCTGGGACTGTAACAATGAGAGGTCGGGATGAGACGGAGGAAGGGCTG
GATACCAAGCTTGCACTGCATTACTATGCCCGTTGGAAGTTTATCCAGGGATTACTCCCAGCGTTAAACAAAGCC
AGTGAGGAAGGAGAAAGCGCCAAAGTCTTCTCTGTCTTTTCCCCAGGAAACGGCAGTGAAATTGATCTAAATGAT
CTTGGCCTCAAGACGACCTTTTCTGCCATCAGAGCGGGACTACAAATGCCTACGTATAATGATTTAATGATCGAG
GCCTTTTATGATTTCAATCCTGCTGTAACATTTATCCATGGCTATCCAGGATTTGTTCGCACTTCACTGTTCACT
AAAAAATCCAACTCGACACTCCTGAACCTCGCTCAACCTTTCATGAACACTTTACTCCGTCCCATATTAACTTCG
CCAGAAGATGCTAGCGAATATATGTGGCATGCTATATTCAACAGTACAGTGGGTGTCTTCAGAACGGGATCGCGG
GGTGAAAATTTGGGGAAGAAGAGATACTTTGGAAGTGAAGAGGCGAAAAAGAAGCTTTGGGAGCATACAGTTGAA
GCTACGACGATTCGTCCGTCATCTGATAGTCCGACGATGTTGTATACGCATGGAATGAGGATGACTATGGGCTGA
Gene >Agabi119p4|589300
ATGTCTTCACTGTCTCTCATTCGTCAAGCCAACTCGAGTTTCAGGCCTCGATTTACGCCGGTAGCTGTGTTTGTG
GGGGGAACAAATGGAATAGGGCGTGGAATGGCTGAAGCTTTCGGACGACACACCCAAGGGAAATCGAATATCGTC
ATCCTCGGGCGTAACAAGGATGCCGCAGACGAGCTCTTCTCTTCACTTCCCTCACCAACCGACAAAATCTATAAT
CGTGATTTCATCCATTGTGATGCTACACGAATGAAGAATGTAGAAACCGCAACGAAAGAAATCCTCGCGCGATAT
TCCAGGGTCAATTTCCTCGTTTTATCACCTGGGACTGTAACAATGAGAGGTCGGGATGAGACGGAGGAAGGGCTG
GATACCAAGCTTGCACTGCATTACTATGCCCGTTGGAAGTTTATCCAGGGATTACTCCCAGCGTTAAACAAAGCC
AGTGAGGAAGGAGAAAGCGCCAAAGTCTTCTCTGTCTTTTCCCCAGGAAACGGCAGTGAAATTGATCTAAATGAT
CTTGGCCTCAAGACGACCTTTTCTGCCATCAGAGCGGGACTACAAATGCCTACGTATAATGATTTAATGATCGAG
GTACGTTGCACCTTTGTCGTTGCTCTTTCTTTGCCGTTACGATCTAATTGACGCCACATCTTACAGGCCTTTTAT
GATTTCAATCCTGCTGTAACATTTATCCATGGCTATCCAGGATTTGTTCGCACTTCACTGTTCACTAAAAAATCC
AACTCGACACTCCTGAACCTCGCTCAACCTTTCATGAACACTTTACTCCGTCCCATATTAACTTCGCCAGAAGAT
GCTAGCGAATATATGTGGCATGCTATATTCAACAGTACAGTGGGTGTCTTCAGAACGGGATCGCGGGGTGAAAAT
TTGGGGAAGAAGAGATACTTTGGAAGTGAAGAGGCGAAAAAGAAGCTTTGGGAGCATACAGTTGAAGCTACGACG
ATTCGTCCGTCATCTGATAGTCCGACGATGTTGTATACGCATGGAATGAGGATGACTATGGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail