Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|584100
Gene name
Locationscaffold_02:1830380..1831303
Strand+
Gene length (bp)923
Transcript length (bp)696
Coding sequence length (bp)696
Protein length (aa) 232

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04099 Sybindin Sybindin-like family 1.0E-20 3 186

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT70|BET5_SCHPO Transport protein particle subunit bet5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bet5 PE=3 SV=2 1 185 2.0E-22
sp|Q2KMM2|TPPC1_RAT Trafficking protein particle complex subunit 1 OS=Rattus norvegicus GN=Trappc1 PE=2 SV=1 89 186 3.0E-17
sp|Q5NCF2|TPPC1_MOUSE Trafficking protein particle complex subunit 1 OS=Mus musculus GN=Trappc1 PE=1 SV=1 89 186 3.0E-17
sp|Q9Y5R8|TPPC1_HUMAN Trafficking protein particle complex subunit 1 OS=Homo sapiens GN=TRAPPC1 PE=1 SV=1 89 186 3.0E-16
sp|Q17QI1|TPPC1_BOVIN Trafficking protein particle complex subunit 1 OS=Bos taurus GN=TRAPPC1 PE=2 SV=1 89 186 3.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT70|BET5_SCHPO Transport protein particle subunit bet5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bet5 PE=3 SV=2 1 185 2.0E-22
sp|Q2KMM2|TPPC1_RAT Trafficking protein particle complex subunit 1 OS=Rattus norvegicus GN=Trappc1 PE=2 SV=1 89 186 3.0E-17
sp|Q5NCF2|TPPC1_MOUSE Trafficking protein particle complex subunit 1 OS=Mus musculus GN=Trappc1 PE=1 SV=1 89 186 3.0E-17
sp|Q9Y5R8|TPPC1_HUMAN Trafficking protein particle complex subunit 1 OS=Homo sapiens GN=TRAPPC1 PE=1 SV=1 89 186 3.0E-16
sp|Q17QI1|TPPC1_BOVIN Trafficking protein particle complex subunit 1 OS=Bos taurus GN=TRAPPC1 PE=2 SV=1 89 186 3.0E-16
sp|Q557G3|TPPC1_DICDI Trafficking protein particle complex subunit 1 OS=Dictyostelium discoideum GN=trappc1-1 PE=3 SV=1 106 185 4.0E-15
sp|Q03630|BET5_YEAST Trafficking protein particle complex subunit BET5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BET5 PE=1 SV=1 105 186 5.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0016192 vesicle-mediated transport Yes
GO:0030008 TRAPP complex Yes
GO:0099023 vesicle tethering complex No
GO:0032991 protein-containing complex No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0140535 intracellular protein-containing complex No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|584100
MTIYSLYIFDRHCTCVYYQDWHRTQRLKPAAEGNILPAVSQAVTPAAAPEKMASSASALGSPRNTLSSSTGIVVA
MNDNAARSTPPPPLSATPQQQPSSATLPFDEETKLVYGVVLSLRNMIKKLSGRDESFTSYRTSTYKLHLHETTSG
YKFVMLTDPKSDSLRPILRQLYAGPFVEYVVRNPLAYSRTFNICITNDKNLFRNPEKSRDIPLCMRRLPALPLEL
LPQHRH*
Coding >Agabi119p4|584100
ATGACGATCTATAGCCTCTATATTTTTGACCGTCACTGCACCTGCGTTTATTATCAGGATTGGCATCGCACTCAA
CGTCTCAAGCCAGCTGCCGAAGGCAACATATTGCCTGCTGTTTCCCAAGCAGTCACACCTGCAGCGGCACCGGAG
AAGATGGCTTCAAGCGCTTCAGCATTGGGCAGCCCACGGAACACTCTTTCGTCGTCGACTGGAATCGTTGTCGCG
ATGAACGACAATGCAGCACGTTCCACGCCCCCACCGCCACTCTCGGCCACTCCTCAGCAACAGCCATCATCAGCA
ACACTTCCGTTTGACGAAGAGACGAAGCTGGTGTACGGTGTTGTTCTCTCTCTCAGAAATATGATCAAGAAGCTG
TCAGGCCGGGACGAATCCTTCACAAGCTATCGAACCTCTACGTACAAACTACATCTCCATGAAACAACCTCAGGA
TACAAGTTCGTCATGTTAACGGACCCTAAGTCCGACTCCCTTCGTCCCATCCTGCGGCAGCTTTATGCGGGTCCT
TTCGTGGAGTATGTTGTTCGGAACCCTTTGGCTTATTCGAGGACTTTCAATATTTGCATAACGAATGACAAAAAT
TTATTCCGAAATCCTGAAAAAAGTCGAGATATTCCATTATGTATGCGGCGTCTCCCCGCCTTGCCTCTCGAACTG
CTGCCTCAGCACCGTCATTAA
Transcript >Agabi119p4|584100
ATGACGATCTATAGCCTCTATATTTTTGACCGTCACTGCACCTGCGTTTATTATCAGGATTGGCATCGCACTCAA
CGTCTCAAGCCAGCTGCCGAAGGCAACATATTGCCTGCTGTTTCCCAAGCAGTCACACCTGCAGCGGCACCGGAG
AAGATGGCTTCAAGCGCTTCAGCATTGGGCAGCCCACGGAACACTCTTTCGTCGTCGACTGGAATCGTTGTCGCG
ATGAACGACAATGCAGCACGTTCCACGCCCCCACCGCCACTCTCGGCCACTCCTCAGCAACAGCCATCATCAGCA
ACACTTCCGTTTGACGAAGAGACGAAGCTGGTGTACGGTGTTGTTCTCTCTCTCAGAAATATGATCAAGAAGCTG
TCAGGCCGGGACGAATCCTTCACAAGCTATCGAACCTCTACGTACAAACTACATCTCCATGAAACAACCTCAGGA
TACAAGTTCGTCATGTTAACGGACCCTAAGTCCGACTCCCTTCGTCCCATCCTGCGGCAGCTTTATGCGGGTCCT
TTCGTGGAGTATGTTGTTCGGAACCCTTTGGCTTATTCGAGGACTTTCAATATTTGCATAACGAATGACAAAAAT
TTATTCCGAAATCCTGAAAAAAGTCGAGATATTCCATTATGTATGCGGCGTCTCCCCGCCTTGCCTCTCGAACTG
CTGCCTCAGCACCGTCATTAA
Gene >Agabi119p4|584100
ATGACGATCTATAGCCTCTATATTTTTGACCGGTGCGTCTGTGGTAAACCCAGCGGTATCAGGCAGAGTCCAATC
TAAGTTCTAGTCACTGCACCTGCGTTTATTATCAGGATTGGCATCGCACTCAACGTCTCAAGCCAGCTGCCGAAG
GCAACATATTGCCTGCTGTTTCCCAAGCAGTCACACCTGCAGCGGCACCGGAGAAGATGGCTTCAAGCGCTTCAG
CATTGGGCAGCCCACGGAACACTCTTTCGTCGTCGACTGGAATCGTTGTCGCGATGAACGACAATGCAGCACGTT
CCACGCCCCCACCGCCACTCTCGGCCACTCCTCAGCAACAGCCATCATCAGCAACACTTCCGTTTGACGAAGAGA
CGAAGCTGGTGTACGGTGTTGTTCTCTCTCTCAGAAATATGATCAAGAAGCTGTCAGGCCGGTGCGTGTCTACTT
TCTCTCGTATTGTTAGCAGGCCAAACTGATAAATAGTCTTATAGGGACGAATCCTTCACAAGCTATCGAACCTCT
ACGTACAAACTACATCTCCATGAAACAACCTCAGGATACAAGTTCGTCATGTTAACGGACCCTAAGTCCGACTCC
CTTCGTCCCATCCTGCGGCAGCTTTATGCGGGTCCTTTCGTGGAGTATGTTGTTCGGAACCCTTTGGTGAAGATG
GATTCTAAGGAACACGGCATTGACAATGAATACTTCCGAACCAGTATTGATAGGCTTATTCGAGGACTTTCAATA
TTTGCATAACGAATGACAAAAATTTATTCCGAAATCCTGAAAAAAGTCGAGGTACAAACCTACGACAAAATGATA
GTCTACGTCACCAATATGCAACTTCCATAGATATTCCATTATGTATGCGGCGTCTCCCCGCCTTGCCTCTCGAAC
TGCTGCCTCAGCACCGTCATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail