Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|583700
Gene name
Locationscaffold_02:1633713..1636741
Strand+
Gene length (bp)3028
Transcript length (bp)2499
Coding sequence length (bp)2499
Protein length (aa) 833

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08616 SPA Stabilization of polarity axis 5.9E-32 413 522
PF07792 Afi1 Docking domain of Afi1 for Arf3 in vesicle trafficking 1.2E-13 10 64

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q5BGR2|MESA_EMENI Protein mesA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mesA PE=1 SV=2 356 797 5.0E-83
sp|Q5BGR2|MESA_EMENI Protein mesA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mesA PE=1 SV=2 7 208 8.0E-38
sp|O94674|YG76_SCHPO AFI1-like protein C776.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC776.06c PE=3 SV=2 381 798 1.0E-37
sp|O94674|YG76_SCHPO AFI1-like protein C776.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC776.06c PE=3 SV=2 10 163 1.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|583700
MTGSGNHCSFVLLAEFDILEGSQLKYQFPQPLGVDESLLATSMLPDGAEAQLDDWTVFFLNQTHFNTISPVLALD
TPESRLVSLPGEETTATRVNKPDLLCVLNLVRTKHDKSLNRGAKVLALAICTRHSFIQIFKPFLLLAIEDYFTDP
SQDCLARLFDAVNSMDLSKAPLLTRPEKLVMRSSDRKDIFADRFTQLTSNSTNGSGANLHKATNSDSSYSSFEEG
LLMRRKDKERAQLGDGKGRRENGVRPRADTESSTSTSSATQSSQSQGSPTDSSFTLGGSAVWVGDESGLELAKDG
TNESNTAASLASTSTISSSRKRRSTGASSSSSAAHSREHHARQINASQSYYDAHLRHAMVKDTHFYHTTVTYRDH
PLPIKMPLATFSEEVGDYSLISLIKVFNSPQLVLGPVHPHLHTSGPLTHPIIILFNGLITGKRIIFLGHKRPAGD
VSNFVLSACALASGCGVVLRGFIERAFPYANLENREEWESVPAYIAGVTNPIFESSRAWDILFDISSGNVTVTRD
IHLTYPTVAPAFGVPSISRSGTLKAESSTASETDLERKEGGRNEGVTTNSDKIFIEDIRTAIEDHFGEGLVRMRF
TEYVYRFVRLAARYEEEVTGTINFGHLSSFFTELPGQGPKLGSGIAFPDEATCSRELAANAHRIEAWRKTSSYQY
YIADHEKLTAGSSIKGFDVAHQLARLRYGKNLADTEVLAIMRTLADNVRTYEQIVELLAYALPQGQGLLQLGFGL
FHQKEGVREATVDLFNNLRAYPVGISFLQSLNHFQRYAYVRQAHARERKMQQQQQQHDVLNEFNLSKPGTHIPRI
QSGSVVN*
Coding >Agabi119p4|583700
ATGACCGGTTCAGGGAACCACTGTTCGTTTGTTCTTCTCGCAGAGTTTGACATATTAGAAGGTTCACAGCTCAAG
TACCAGTTTCCTCAACCCCTCGGTGTCGATGAGAGCCTACTTGCAACGTCTATGCTCCCTGATGGTGCAGAAGCA
CAGCTCGATGACTGGACTGTCTTCTTCCTCAACCAGACTCATTTCAACACGATATCACCTGTGCTGGCCCTTGAC
ACTCCAGAGAGTAGGCTTGTCAGTCTTCCCGGGGAGGAAACAACAGCAACCAGAGTAAACAAGCCAGACTTGCTT
TGTGTGTTGAACCTGGTGCGGACAAAGCACGATAAATCTCTAAATCGTGGTGCCAAAGTGCTAGCACTCGCAATA
TGCACGCGACATTCTTTCATTCAAATATTCAAGCCGTTTCTGTTGCTCGCAATTGAAGACTATTTCACAGATCCT
TCTCAAGATTGCCTTGCCCGGCTCTTTGATGCAGTCAATTCCATGGACTTGTCGAAAGCACCACTCCTTACACGA
CCGGAGAAGCTGGTCATGCGATCATCGGACCGAAAGGACATATTTGCCGACCGATTTACCCAACTTACTTCTAAC
TCAACCAATGGCTCTGGAGCGAACCTTCACAAAGCAACGAACTCAGATAGTTCATATTCGAGCTTCGAAGAAGGT
CTCCTGATGCGCAGAAAGGACAAAGAGAGGGCTCAACTTGGTGACGGAAAGGGGAGACGAGAAAACGGCGTCCGT
CCTCGGGCCGATACCGAATCGAGCACTTCCACCTCCTCGGCTACTCAGTCGAGCCAGTCGCAGGGCTCGCCAACC
GACTCGTCCTTTACACTCGGAGGTAGTGCAGTCTGGGTTGGTGATGAAAGTGGACTCGAACTTGCAAAAGATGGT
ACCAATGAATCAAATACTGCAGCTTCGCTGGCTAGTACAAGCACAATTTCGTCTTCGCGTAAACGGAGATCAACA
GGTGCTTCTTCGTCATCCTCCGCCGCCCATAGTCGTGAACATCACGCCCGCCAAATCAACGCCTCACAATCGTAT
TATGACGCTCACCTTAGGCATGCCATGGTGAAGGATACGCACTTCTACCATACGACAGTCACTTATCGAGATCAC
CCTCTTCCCATCAAAATGCCACTCGCTACATTTTCTGAAGAGGTTGGAGATTATTCCCTAATATCTTTGATTAAA
GTGTTCAACTCTCCCCAGCTGGTTTTGGGGCCGGTGCACCCACATCTACATACCAGCGGACCGCTCACACACCCA
ATCATCATTCTTTTCAACGGTTTAATTACAGGGAAGCGTATCATCTTTTTGGGTCACAAGCGCCCAGCTGGAGAT
GTTTCAAACTTTGTTCTGTCGGCGTGCGCTCTTGCCTCTGGGTGTGGTGTGGTGCTTCGAGGTTTCATTGAGCGG
GCTTTTCCTTACGCGAACTTGGAAAATAGGGAAGAGTGGGAGTCAGTGCCGGCGTACATTGCTGGAGTGACCAAT
CCGATCTTCGAGTCTTCCAGAGCTTGGGATATACTTTTCGACATCAGTTCCGGGAACGTGACTGTGACTAGAGAT
ATCCATTTGACCTACCCTACTGTTGCGCCAGCTTTCGGGGTGCCTTCCATAAGCCGATCTGGTACACTGAAGGCT
GAATCATCCACAGCCTCTGAGACGGATTTAGAACGTAAAGAGGGAGGAAGAAATGAAGGGGTCACTACTAATAGT
GACAAGATTTTCATTGAAGATATTCGTACTGCAATTGAGGATCATTTTGGTGAGGGCCTTGTCCGCATGCGATTC
ACGGAATATGTCTATCGCTTTGTGCGCCTTGCTGCACGGTACGAAGAGGAAGTTACTGGGACCATCAACTTCGGC
CATCTTAGCAGCTTTTTCACTGAACTTCCGGGACAAGGGCCCAAACTTGGTAGTGGTATTGCGTTTCCTGATGAA
GCGACTTGTTCCCGGGAGCTCGCTGCCAACGCGCATCGGATAGAAGCCTGGCGAAAGACCAGTTCTTATCAATAC
TATATTGCAGACCACGAAAAACTCACGGCCGGTTCATCCATCAAAGGATTTGACGTAGCGCATCAATTAGCCCGA
CTGCGTTATGGAAAGAACCTTGCAGATACAGAGGTTCTTGCGATCATGCGAACGCTAGCGGACAATGTTCGAACG
TATGAGCAAATAGTCGAGCTGTTGGCATACGCTCTGCCTCAAGGACAAGGGCTTTTGCAGCTCGGGTTTGGTTTA
TTCCATCAAAAAGAAGGTGTTCGTGAGGCTACAGTTGATCTTTTCAACAATCTAAGAGCATACCCGGTCGGGATT
TCTTTCCTCCAAAGCCTCAATCATTTCCAACGTTATGCTTATGTCCGTCAAGCGCACGCAAGGGAGAGAAAAATG
CAACAGCAACAGCAACAGCATGATGTACTGAATGAATTCAACCTTTCGAAACCTGGGACACACATTCCACGGATT
CAATCCGGCTCCGTCGTCAACTGA
Transcript >Agabi119p4|583700
ATGACCGGTTCAGGGAACCACTGTTCGTTTGTTCTTCTCGCAGAGTTTGACATATTAGAAGGTTCACAGCTCAAG
TACCAGTTTCCTCAACCCCTCGGTGTCGATGAGAGCCTACTTGCAACGTCTATGCTCCCTGATGGTGCAGAAGCA
CAGCTCGATGACTGGACTGTCTTCTTCCTCAACCAGACTCATTTCAACACGATATCACCTGTGCTGGCCCTTGAC
ACTCCAGAGAGTAGGCTTGTCAGTCTTCCCGGGGAGGAAACAACAGCAACCAGAGTAAACAAGCCAGACTTGCTT
TGTGTGTTGAACCTGGTGCGGACAAAGCACGATAAATCTCTAAATCGTGGTGCCAAAGTGCTAGCACTCGCAATA
TGCACGCGACATTCTTTCATTCAAATATTCAAGCCGTTTCTGTTGCTCGCAATTGAAGACTATTTCACAGATCCT
TCTCAAGATTGCCTTGCCCGGCTCTTTGATGCAGTCAATTCCATGGACTTGTCGAAAGCACCACTCCTTACACGA
CCGGAGAAGCTGGTCATGCGATCATCGGACCGAAAGGACATATTTGCCGACCGATTTACCCAACTTACTTCTAAC
TCAACCAATGGCTCTGGAGCGAACCTTCACAAAGCAACGAACTCAGATAGTTCATATTCGAGCTTCGAAGAAGGT
CTCCTGATGCGCAGAAAGGACAAAGAGAGGGCTCAACTTGGTGACGGAAAGGGGAGACGAGAAAACGGCGTCCGT
CCTCGGGCCGATACCGAATCGAGCACTTCCACCTCCTCGGCTACTCAGTCGAGCCAGTCGCAGGGCTCGCCAACC
GACTCGTCCTTTACACTCGGAGGTAGTGCAGTCTGGGTTGGTGATGAAAGTGGACTCGAACTTGCAAAAGATGGT
ACCAATGAATCAAATACTGCAGCTTCGCTGGCTAGTACAAGCACAATTTCGTCTTCGCGTAAACGGAGATCAACA
GGTGCTTCTTCGTCATCCTCCGCCGCCCATAGTCGTGAACATCACGCCCGCCAAATCAACGCCTCACAATCGTAT
TATGACGCTCACCTTAGGCATGCCATGGTGAAGGATACGCACTTCTACCATACGACAGTCACTTATCGAGATCAC
CCTCTTCCCATCAAAATGCCACTCGCTACATTTTCTGAAGAGGTTGGAGATTATTCCCTAATATCTTTGATTAAA
GTGTTCAACTCTCCCCAGCTGGTTTTGGGGCCGGTGCACCCACATCTACATACCAGCGGACCGCTCACACACCCA
ATCATCATTCTTTTCAACGGTTTAATTACAGGGAAGCGTATCATCTTTTTGGGTCACAAGCGCCCAGCTGGAGAT
GTTTCAAACTTTGTTCTGTCGGCGTGCGCTCTTGCCTCTGGGTGTGGTGTGGTGCTTCGAGGTTTCATTGAGCGG
GCTTTTCCTTACGCGAACTTGGAAAATAGGGAAGAGTGGGAGTCAGTGCCGGCGTACATTGCTGGAGTGACCAAT
CCGATCTTCGAGTCTTCCAGAGCTTGGGATATACTTTTCGACATCAGTTCCGGGAACGTGACTGTGACTAGAGAT
ATCCATTTGACCTACCCTACTGTTGCGCCAGCTTTCGGGGTGCCTTCCATAAGCCGATCTGGTACACTGAAGGCT
GAATCATCCACAGCCTCTGAGACGGATTTAGAACGTAAAGAGGGAGGAAGAAATGAAGGGGTCACTACTAATAGT
GACAAGATTTTCATTGAAGATATTCGTACTGCAATTGAGGATCATTTTGGTGAGGGCCTTGTCCGCATGCGATTC
ACGGAATATGTCTATCGCTTTGTGCGCCTTGCTGCACGGTACGAAGAGGAAGTTACTGGGACCATCAACTTCGGC
CATCTTAGCAGCTTTTTCACTGAACTTCCGGGACAAGGGCCCAAACTTGGTAGTGGTATTGCGTTTCCTGATGAA
GCGACTTGTTCCCGGGAGCTCGCTGCCAACGCGCATCGGATAGAAGCCTGGCGAAAGACCAGTTCTTATCAATAC
TATATTGCAGACCACGAAAAACTCACGGCCGGTTCATCCATCAAAGGATTTGACGTAGCGCATCAATTAGCCCGA
CTGCGTTATGGAAAGAACCTTGCAGATACAGAGGTTCTTGCGATCATGCGAACGCTAGCGGACAATGTTCGAACG
TATGAGCAAATAGTCGAGCTGTTGGCATACGCTCTGCCTCAAGGACAAGGGCTTTTGCAGCTCGGGTTTGGTTTA
TTCCATCAAAAAGAAGGTGTTCGTGAGGCTACAGTTGATCTTTTCAACAATCTAAGAGCATACCCGGTCGGGATT
TCTTTCCTCCAAAGCCTCAATCATTTCCAACGTTATGCTTATGTCCGTCAAGCGCACGCAAGGGAGAGAAAAATG
CAACAGCAACAGCAACAGCATGATGTACTGAATGAATTCAACCTTTCGAAACCTGGGACACACATTCCACGGATT
CAATCCGGCTCCGTCGTCAACTGA
Gene >Agabi119p4|583700
ATGACCGGTTCAGGGAACCACTGTTCGTTTGTTCTTCTCGCAGAGTTTGACATATTAGAAGGTTCACAGCTCAAG
TACCAGTTTCCTCAACCCCTCGGTGTCGATGAGAGGTACACATACCTATCAGTGTTACTTCTTGGTCGGAATTAA
TTCGTGTCCGTCTTGTCTCCAGCCTACTTGCAACGTCTATGCTCCCTGATGGTGCAGAAGCACAGCTCGATGACT
GGACTGTCTTCTTCCTCAACCAGACTCATTTCAACACGATATCACCTGTGCTGGCCCTTGACACTCCAGAGAGTA
GGCTTGTCAGTCTTCCCGGGGAGGAAACAACAGCAACCAGAGTAAACAAGCCAGACTTGCTTTGTGTGTTGAACC
TGGTGCGGACAAAGCACGATAAATCTCTAAATCGGTACGTGAACCTTTGACGGACTAAAACCATACCTGAGCCCC
TGATCGTCTGGTTAGTGGTGCCAAAGTGCTAGCACTCGCAATATGCACGCGACATTCTTTCATTCAAATATTCAA
GGCAAGTCCAGATCACAATAGGGTTGTGGAGTCGACGGCTCACTGAGCTATCTGCGATCAGCCGTTTCTGTTGCT
CGCAATTGAAGACTATTTCACAGATCCTTCTCAAGATTGCCTTGCCCGGCTCTTTGATGCAGTCAATTCCATGGA
CTTGTCGAAAGCACCACTCCTTACACGACCGGAGAAGCTGGTCATGCGATCATCGGACCGAAAGGACATATTTGC
CGACCGATTTACCCAACTTACTTCTAACTCAACCAATGGCTCTGGAGCGAACCTTCACAAAGCAACGAACTCAGA
TAGTTCATATTCGAGCTTCGAAGAAGGTCTCCTGATGCGCAGAAAGGACAAAGAGAGGGCTCAACTTGGTGACGG
AAAGGGGAGACGAGAAAACGGCGTCCGTCCTCGGGCCGATACCGAATCGAGCACTTCCACCTCCTCGGCTACTCA
GTCGAGCCAGTCGCAGGGCTCGCCAACCGACTCGTCCTTTACACTCGGAGGTAGTGCAGTCTGGGTTGGTGATGA
AAGTGGACTCGAACTTGCAAAAGATGGTACCAATGAATCAAATACTGCAGCTTCGCTGGCTAGTACAAGCACAAT
TTCGTCTTCGCGTAAACGGAGATCAACAGGTGCTTCTTCGTCATCCTCCGCCGCCCATAGTCGTGAACATCACGC
CCGCCAAATCAACGCCTCACAATCGTATTATGACGCTCACCTTAGGCATGCCATGGTGAAGGATACGCACTTCTA
CCATACGACAGTCACTTATCGAGATCACCCTCTTCCCATCAAAATGCCACTCGCTACATTTTCTGAAGAGGTTGG
AGATGTATGTCGATTGACGCCGTTTCTCTTGTCACCTGCTGATATTCAGCTTTTAGTATTCCCTAATATCTTTGA
TTAAAGTGTTCAACTCTCCCCAGCTGGTTTTGGGGCCGGTGCACCCACATCTACATACCAGCGGACCGCTCACAC
ACCCAATCATCATTCTTTTCAACGGTTTAATTACAGGGAAGCGTATCATCTTTTTGGGTCACAAGCGCCCAGCTG
GAGATGTTTCAAACTTTGTTCTGTCGGCGTGCGCTCTTGCCTCTGGGTGTGGTGTGGTGCTTCGAGGTTTCATTG
AGCGGGCTTTTCCTTACGCGAACTTGGAAAATAGGGAAGAGTGGGAGTCAGTGTAAGTATTTGTCCGTTCTTCCC
GAATGGTCACATGTTTACTTCGCCTCCAGGCCGGCGTACATTGCTGGAGTGACCAATCCGATCTTCGAGTCTTCC
AGAGCTTGGGATATACTTTTCGACATCAGTTCCGGGAACGTGACTGTGACTAGAGATATCCATTTGACCTACCCT
ACTGTTGCGCCAGCTTTCGGGGTGCCTTCCATAAGCCGATCTGGTACACTGAAGGCTGAATCATCCACAGCCTCT
GAGACGGATTTAGAACGTAAAGAGGGAGGAAGAAATGAAGGGGTCACTACTAATAGTGACAAGATTTTCATTGAA
GATGTGGGTAAAAATTTTGCTCTAAACGATTGTCAACCATCAAATGACCTCTGGTGGTGACGTAGATTCGTACTG
CAATTGAGGATCATTTTGGTGAGGGCCTTGTCCGCATGCGATTCACGGAATATGTCTATCGCTTTGTGCGCCTTG
CTGCACGGTACGAAGAGGAAGTTACTGGGACCATCAACTTCGGCCATCTTAGCAGCTTTTTCACTGAACTTCCGG
GACAAGGGCCCAAACTTGGTAGTGGTATTGCGTTTCCTGATGAAGCGACTTGTTCCCGGGAGCTCGCTGCCAACG
CGCATCGGATAGAAGCCTGGCGAAAGACCAGTTCTTATCAATACTATATTGCAGTGCGTAAATCTGCCATACATA
TGCTACTTTGCACTGGTTTGTTGAGAAGGAGATGTTGTACGCTAATTTAGGACCACGAAAAACTCACGGCCGGTT
CATCCATCAAAGGATTTGACGTAGCGCATCAATTAGCCCGACTGCGTTATGGAAAGAACCTTGCAGATACAGAGG
TTCTTGCGATCATGCGAACGCTAGCGGACAATGTTCGAACGTATGAGCAAATAGTCGAGGTCAGTGATCTATTTC
TAGAATGACTGCAGGTCGTGATAAGATGTGGTCAGCTGTTGGCATACGCTCTGCCTCAAGGACAAGGGCTTTTGC
AGCTCGGGTTTGGTTTATTCCATCAAAAAGAAGGTGTTCGTGAGGCTACAGTTGATCTTTTCAACAATCTAAGAG
CATACCCGGTATGTGAGCTTGTAATGTTTTCGGGTAGAACCTAGCTCATTGTGAGGTTGGCGTCGAACAGGTCGG
GATTTCTTTCCTCCAAAGCCTCAATCATTTCCAACGTTATGCTTATGTCCGTCAAGCGCACGCAAGGGAGAGAAA
AATGCAACAGCAACAGCAACAGCATGATGTACTGAATGAATTCAACCTTTCGAAACCTGGGACACACATTCCACG
GATTCAATCCGGCTCCGTCGTCAACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail