Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|579950
Gene name
Locationscaffold_02:1153525..1157956
Strand+
Gene length (bp)4431
Transcript length (bp)3264
Coding sequence length (bp)3264
Protein length (aa) 1088

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01244 Peptidase_M19 Membrane dipeptidase (Peptidase family M19) 1.1E-105 718 1053
PF00890 FAD_binding_2 FAD binding domain 4.5E-86 4 440
PF00173 Cyt-b5 Cytochrome b5-like Heme/Steroid binding domain 1.7E-21 506 576
PF01266 DAO FAD dependent oxidoreductase 2.3E-13 4 219
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 1.0E-08 3 201
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 9.9E-08 6 67
PF12831 FAD_oxidored FAD dependent oxidoreductase 1.1E-07 4 73

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13755|OSM1_SCHPO Fumarate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=osm1 PE=3 SV=1 3 460 3.0E-145
sp|P21375|OSM1_YEAST Fumarate reductase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OSM1 PE=1 SV=3 4 453 1.0E-95
sp|C5PCN6|DPEP2_COCP7 Putative dipeptidase CPC735_014430 OS=Coccidioides posadasii (strain C735) GN=CPC735_014430 PE=3 SV=1 646 1082 4.0E-95
sp|E9CV02|DPEP2_COCPS Putative dipeptidase CPSG_01350 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=CPSG_01350 PE=3 SV=1 646 1082 5.0E-95
sp|P32614|FRDS_YEAST Fumarate reductase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRD1 PE=1 SV=1 1 453 2.0E-92
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13755|OSM1_SCHPO Fumarate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=osm1 PE=3 SV=1 3 460 3.0E-145
sp|P21375|OSM1_YEAST Fumarate reductase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OSM1 PE=1 SV=3 4 453 1.0E-95
sp|C5PCN6|DPEP2_COCP7 Putative dipeptidase CPC735_014430 OS=Coccidioides posadasii (strain C735) GN=CPC735_014430 PE=3 SV=1 646 1082 4.0E-95
sp|E9CV02|DPEP2_COCPS Putative dipeptidase CPSG_01350 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=CPSG_01350 PE=3 SV=1 646 1082 5.0E-95
sp|P32614|FRDS_YEAST Fumarate reductase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRD1 PE=1 SV=1 1 453 2.0E-92
sp|D4B2N2|DPEP1_ARTBC Putative dipeptidase ARB_02715 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02715 PE=3 SV=1 705 1077 8.0E-92
sp|P16444|DPEP1_HUMAN Dipeptidase 1 OS=Homo sapiens GN=DPEP1 PE=1 SV=3 718 1070 5.0E-91
sp|D4DEJ7|DPEP1_TRIVH Putative dipeptidase TRV_05564 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_05564 PE=3 SV=1 705 1077 8.0E-91
sp|E5R2Q7|DPEP1_ARTGP Putative dipeptidase MGYG_00085 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_00085 PE=3 SV=1 704 1077 5.0E-90
sp|C5PCZ0|DPEP1_COCP7 Putative dipeptidase CPC735_015490 OS=Coccidioides posadasii (strain C735) GN=CPC735_015490 PE=3 SV=1 709 1063 2.0E-89
sp|C5FK77|DPEP1_ARTOC Putative dipeptidase MCYG_02918 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_02918 PE=3 SV=1 686 1077 4.0E-89
sp|C7ZIE1|DPEP2_NECH7 Putative dipeptidase NECHADRAFT_87110 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=NECHADRAFT_87110 PE=3 SV=1 646 1077 2.0E-87
sp|E9D269|DPEP1_COCPS Putative dipeptidase CPSG_03667 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=CPSG_03667 PE=3 SV=1 709 1063 1.0E-86
sp|B8LWT1|DPEP2_TALSN Putative dipeptidase TSTA_079200 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=TSTA_079200 PE=3 SV=1 708 1077 2.0E-86
sp|O14124|DPEH1_SCHPO Uncharacterized dipeptidase C3A11.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3A11.10c PE=1 SV=1 703 1056 2.0E-86
sp|P22412|DPEP1_PIG Dipeptidase 1 OS=Sus scrofa GN=DPEP1 PE=1 SV=1 715 1070 1.0E-85
sp|P31429|DPEP1_RABIT Dipeptidase 1 OS=Oryctolagus cuniculus GN=DPEP1 PE=1 SV=1 715 1070 2.0E-85
sp|P31430|DPEP1_RAT Dipeptidase 1 OS=Rattus norvegicus GN=Dpep1 PE=2 SV=2 718 1064 3.0E-85
sp|C4JQN7|DPEP2_UNCRE Putative dipeptidase UREG_03382 OS=Uncinocarpus reesii (strain UAMH 1704) GN=UREG_03382 PE=3 SV=1 656 1077 5.0E-85
sp|O59832|DPEH2_SCHPO Uncharacterized dipeptidase C965.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.12 PE=3 SV=1 718 1062 1.0E-84
sp|Q3SZM7|DPEP1_BOVIN Dipeptidase 1 OS=Bos taurus GN=DPEP1 PE=2 SV=1 715 1070 1.0E-84
sp|P43477|DPEP1_SHEEP Dipeptidase 1 OS=Ovis aries GN=DPEP1 PE=1 SV=1 715 1070 1.0E-84
sp|Q8C255|DPEP2_MOUSE Dipeptidase 2 OS=Mus musculus GN=Dpep2 PE=1 SV=1 704 1076 1.0E-83
sp|Q5M872|DPEP2_RAT Dipeptidase 2 OS=Rattus norvegicus GN=Dpep2 PE=2 SV=1 704 1076 2.0E-83
sp|Q5U2X4|DPEP3_RAT Dipeptidase 3 OS=Rattus norvegicus GN=Dpep3 PE=2 SV=1 709 1077 4.0E-83
sp|Q9DA79|DPEP3_MOUSE Dipeptidase 3 OS=Mus musculus GN=Dpep3 PE=1 SV=1 709 1077 6.0E-83
sp|P31428|DPEP1_MOUSE Dipeptidase 1 OS=Mus musculus GN=Dpep1 PE=1 SV=2 715 1070 8.0E-83
sp|Q9H4A9|DPEP2_HUMAN Dipeptidase 2 OS=Homo sapiens GN=DPEP2 PE=1 SV=2 712 1075 2.0E-82
sp|Q4R7M2|DPEP3_MACFA Dipeptidase 3 OS=Macaca fascicularis GN=DPEP3 PE=2 SV=2 710 1075 1.0E-77
sp|Q9H4B8|DPEP3_HUMAN Dipeptidase 3 OS=Homo sapiens GN=DPEP3 PE=2 SV=2 715 1075 2.0E-76
sp|Q9Z4P0|FRD2_SHEFN Fumarate reductase flavoprotein subunit OS=Shewanella frigidimarina (strain NCIMB 400) GN=ifcA PE=1 SV=1 3 459 5.0E-68
sp|P83223|FRDA_SHEON Fumarate reductase flavoprotein subunit OS=Shewanella oneidensis (strain MR-1) GN=SO_0970 PE=1 SV=2 24 457 1.0E-63
sp|P0C278|FRDA_SHEFR Fumarate reductase flavoprotein subunit OS=Shewanella frigidimarina GN=fccA PE=1 SV=1 14 457 3.0E-57
sp|Q07WU7|FRDA_SHEFN Fumarate reductase flavoprotein subunit OS=Shewanella frigidimarina (strain NCIMB 400) GN=fccA PE=1 SV=2 14 457 4.0E-57
sp|Q8CVD0|URDA_SHEON Urocanate reductase OS=Shewanella oneidensis (strain MR-1) GN=urdA PE=1 SV=1 24 455 8.0E-50
sp|Q8XNE2|NADB_CLOPE L-aspartate oxidase OS=Clostridium perfringens (strain 13 / Type A) GN=nadB PE=3 SV=1 1 458 7.0E-26
sp|P27509|YPQQ_KLEPN Uncharacterized protein in pqqA 5'region (Fragment) OS=Klebsiella pneumoniae PE=3 SV=1 799 1053 6.0E-25
sp|D9PU00|TFRA_METTM Fumarate reductase (CoM/CoB) subunit A OS=Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) GN=tfrA PE=1 SV=1 2 467 2.0E-24
sp|O66973|NADB_AQUAE L-aspartate oxidase OS=Aquifex aeolicus (strain VF5) GN=nadB PE=3 SV=1 2 447 5.0E-24
sp|Q60356|Y033_METJA Uncharacterized FAD-dependent oxidoreductase MJ0033 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0033 PE=3 SV=1 23 458 3.0E-23
sp|Q8TZL4|NADB_PYRFU L-aspartate oxidase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=nadB PE=3 SV=1 3 447 4.0E-23
sp|P74562|NADB_SYNY3 L-aspartate oxidase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=nadB PE=3 SV=1 4 447 3.0E-22
sp|Q9X8N8|NADB_STRCO L-aspartate oxidase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=nadB PE=3 SV=1 14 446 1.0E-21
sp|Q9V2R0|NADB_PYRAB L-aspartate oxidase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=nadB PE=3 SV=1 3 447 2.0E-21
sp|Q97K95|NADB_CLOAB L-aspartate oxidase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=nadB PE=3 SV=1 4 453 2.0E-21
sp|O57765|NADB_PYRHO L-aspartate oxidase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=nadB PE=3 SV=1 3 447 3.0E-21
sp|Q8YXJ6|NADB_NOSS1 L-aspartate oxidase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=nadB PE=3 SV=1 151 462 1.0E-20
sp|Q51363|NADB_PSEAE L-aspartate oxidase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=nadB PE=3 SV=1 4 460 3.0E-20
sp|P44894|FRDA_HAEIN Fumarate reductase flavoprotein subunit OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=frdA PE=3 SV=1 62 463 5.0E-20
sp|Q8ZQU3|SDHA_SALTY Succinate dehydrogenase flavoprotein subunit OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=sdhA PE=3 SV=1 162 451 6.0E-20
sp|P0AC41|SDHA_ECOLI Succinate dehydrogenase flavoprotein subunit OS=Escherichia coli (strain K12) GN=sdhA PE=1 SV=1 162 451 2.0E-19
sp|P0AC42|SDHA_ECOL6 Succinate dehydrogenase flavoprotein subunit OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=sdhA PE=3 SV=1 162 451 2.0E-19
sp|P0AC43|SDHA_ECO57 Succinate dehydrogenase flavoprotein subunit OS=Escherichia coli O157:H7 GN=sdhA PE=3 SV=1 162 451 2.0E-19
sp|Q9UTJ7|SDHA_SCHPO Probable succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sdh1 PE=2 SV=1 5 450 3.0E-19
sp|Q972D2|NADB_SULTO L-aspartate oxidase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=nadB PE=1 SV=1 3 447 5.0E-19
sp|Q8U8J4|NADB_AGRFC L-aspartate oxidase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=nadB PE=3 SV=1 5 447 6.0E-19
sp|P20922|FRDA_PROVU Fumarate reductase flavoprotein subunit OS=Proteus vulgaris GN=frdA PE=3 SV=1 41 464 2.0E-18
sp|Q92R32|NADB_RHIME L-aspartate oxidase OS=Rhizobium meliloti (strain 1021) GN=nadB PE=3 SV=1 4 446 4.0E-18
sp|Q9K107|NADB_NEIMB L-aspartate oxidase OS=Neisseria meningitidis serogroup B (strain MC58) GN=nadB PE=3 SV=1 70 453 4.0E-18
sp|Q9JSX4|NADB_NEIMA L-aspartate oxidase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=nadB PE=3 SV=1 70 453 2.0E-17
sp|P09437|CYB2_WICAO Cytochrome b2, mitochondrial OS=Wickerhamomyces anomalus GN=CYB2 PE=1 SV=2 452 570 3.0E-17
sp|Q8XA23|NADB_ECO57 L-aspartate oxidase OS=Escherichia coli O157:H7 GN=nadB PE=3 SV=1 2 447 3.0E-17
sp|P08065|SDHA_BACSU Succinate dehydrogenase flavoprotein subunit OS=Bacillus subtilis (strain 168) GN=sdhA PE=3 SV=4 2 516 3.0E-17
sp|P00363|FRDA_ECOLI Fumarate reductase flavoprotein subunit OS=Escherichia coli (strain K12) GN=frdA PE=1 SV=3 62 482 4.0E-17
sp|Q8Z4K0|NADB_SALTI L-aspartate oxidase OS=Salmonella typhi GN=nadB PE=3 SV=1 2 447 8.0E-17
sp|Q97ZC5|NADB_SULSO L-aspartate oxidase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=nadB PE=3 SV=2 3 447 9.0E-17
sp|Q8ZMX9|NADB_SALTY L-aspartate oxidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=nadB PE=3 SV=1 2 447 9.0E-17
sp|Q9ZPX5|SDHA2_ARATH Succinate dehydrogenase [ubiquinone] flavoprotein subunit 2, mitochondrial OS=Arabidopsis thaliana GN=SDH1-2 PE=1 SV=1 162 476 2.0E-16
sp|O06913|FRDA_HELPY Fumarate reductase flavoprotein subunit OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=frdA PE=3 SV=2 5 461 2.0E-16
sp|Q7ZVF3|SDHA_DANRE Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Danio rerio GN=sdha PE=2 SV=2 22 450 4.0E-16
sp|Q9KPA4|NADB_VIBCH L-aspartate oxidase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=nadB PE=3 SV=2 4 462 4.0E-16
sp|Q8XWM7|NADB1_RALSO L-aspartate oxidase 1 OS=Ralstonia solanacearum (strain GMI1000) GN=nadB1 PE=3 SV=1 4 448 5.0E-16
sp|Q6ZDY8|SDHA_ORYSJ Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Oryza sativa subsp. japonica GN=SDH1 PE=1 SV=1 22 452 8.0E-16
sp|O82663|SDHA1_ARATH Succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial OS=Arabidopsis thaliana GN=SDH1-1 PE=1 SV=1 22 452 1.0E-15
sp|Q9KDJ5|NADB_BACHD L-aspartate oxidase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=nadB PE=3 SV=1 3 446 1.0E-15
sp|P38032|NADB_BACSU L-aspartate oxidase OS=Bacillus subtilis (strain 168) GN=nadB PE=3 SV=1 27 448 1.0E-15
sp|Q8Y5N4|NADB_LISMO L-aspartate oxidase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=nadB PE=3 SV=1 3 448 1.0E-15
sp|P9WN91|FRDA_MYCTU Fumarate reductase flavoprotein subunit OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=frdA PE=1 SV=1 159 447 2.0E-15
sp|P9WN90|FRDA_MYCTO Fumarate reductase flavoprotein subunit OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=frdA PE=3 SV=1 159 447 2.0E-15
sp|P64175|FRDA_MYCBO Fumarate reductase flavoprotein subunit OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=frdA PE=3 SV=1 159 447 2.0E-15
sp|Q9ZMP0|FRDA_HELPJ Fumarate reductase flavoprotein subunit OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=frdA PE=3 SV=1 5 461 2.0E-15
sp|Q09508|SDHA_CAEEL Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Caenorhabditis elegans GN=sdha-1 PE=2 SV=3 62 466 2.0E-15
sp|P00175|CYB2_YEAST Cytochrome b2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYB2 PE=1 SV=1 508 590 2.0E-15
sp|Q9U3X4|SDHA_DICDI Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Dictyostelium discoideum GN=sdhA PE=3 SV=1 159 462 4.0E-15
sp|Q00711|SDHA_YEAST Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SDH1 PE=1 SV=1 188 448 5.0E-15
sp|P51054|SDHA_COXBU Succinate dehydrogenase flavoprotein subunit OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=sdhA PE=3 SV=1 217 451 5.0E-15
sp|Q9YHT1|SDHA_CHICK Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Gallus gallus GN=SDHA PE=1 SV=2 188 450 6.0E-15
sp|Q920L2|SDHA_RAT Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Rattus norvegicus GN=Sdha PE=1 SV=1 22 450 6.0E-15
sp|P31038|SDHA_RICPR Succinate dehydrogenase flavoprotein subunit OS=Rickettsia prowazekii (strain Madrid E) GN=sdhA PE=3 SV=1 188 462 9.0E-15
sp|Q8K2B3|SDHA_MOUSE Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Mus musculus GN=Sdha PE=1 SV=1 22 450 1.0E-14
sp|P31040|SDHA_HUMAN Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Homo sapiens GN=SDHA PE=1 SV=2 22 450 1.0E-14
sp|Q92J97|SDHA_RICCN Succinate dehydrogenase flavoprotein subunit OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=sdhA PE=3 SV=1 188 462 2.0E-14
sp|Q94523|SDHA_DROME Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Drosophila melanogaster GN=SdhA PE=2 SV=3 188 453 2.0E-14
sp|Q5R616|SDHA_PONAB Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Pongo abelii GN=SDHA PE=2 SV=1 22 453 2.0E-14
sp|P39865|NIA1_PHAVU Nitrate reductase [NADH] 1 OS=Phaseolus vulgaris GN=NIA1 PE=3 SV=1 492 563 2.0E-14
sp|Q68XN9|SDHA_RICTY Succinate dehydrogenase flavoprotein subunit OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=sdhA PE=3 SV=1 188 455 2.0E-14
sp|Q8XQG4|NADB2_RALSO L-aspartate oxidase 2 OS=Ralstonia solanacearum (strain GMI1000) GN=nadB2 PE=3 SV=1 68 455 4.0E-14
sp|Q9A4C3|NADB_CAUCR L-aspartate oxidase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=nadB PE=3 SV=1 151 446 4.0E-14
sp|P23312|NIA_SPIOL Nitrate reductase [NADH] OS=Spinacia oleracea GN=NIA PE=2 SV=1 467 576 5.0E-14
sp|Q0QF01|SDHA_PIG Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Sus scrofa GN=SDHA PE=1 SV=2 22 453 5.0E-14
sp|Q9PC57|NADB_XYLFA L-aspartate oxidase OS=Xylella fastidiosa (strain 9a5c) GN=nadB PE=3 SV=1 5 447 6.0E-14
sp|P27968|NIA7_HORVU Nitrate reductase [NAD(P)H] OS=Hordeum vulgare GN=NAR-7 PE=2 SV=1 467 594 6.0E-14
sp|Q4UJM1|SDHA_RICFE Succinate dehydrogenase flavoprotein subunit OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=sdhA PE=3 SV=1 188 462 7.0E-14
sp|Q8HXW3|SDHA_MACFA Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Macaca fascicularis GN=SDHA PE=2 SV=1 22 453 7.0E-14
sp|P07783|YPQR_ACICA Uncharacterized protein in PQQ-III 3'region (Fragment) OS=Acinetobacter calcoaceticus PE=3 SV=1 720 994 8.0E-14
sp|P17569|NIA_CUCMA Nitrate reductase [NADH] OS=Cucurbita maxima PE=2 SV=1 479 563 9.0E-14
sp|Q801S2|SDHAB_XENLA Succinate dehydrogenase [ubiquinone] flavoprotein subunit B, mitochondrial OS=Xenopus laevis GN=sdha-b PE=2 SV=1 188 450 1.0E-13
sp|Q87D19|NADB_XYLFT L-aspartate oxidase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=nadB PE=3 SV=1 5 447 1.0E-13
sp|Q6PA58|SDHAA_XENLA Succinate dehydrogenase [ubiquinone] flavoprotein subunit A, mitochondrial OS=Xenopus laevis GN=sdha-a PE=2 SV=1 188 450 1.0E-13
sp|Q1RHB9|SDHA_RICBR Succinate dehydrogenase flavoprotein subunit OS=Rickettsia bellii (strain RML369-C) GN=sdhA PE=3 SV=1 188 462 2.0E-13
sp|P43101|NIA_CICIN Nitrate reductase [NADH] OS=Cichorium intybus GN=NIA PE=2 SV=1 480 563 2.0E-13
sp|P17412|FRDA_WOLSU Fumarate reductase flavoprotein subunit OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=frdA PE=1 SV=3 5 452 2.0E-13
sp|P39870|NIA2_SOYBN Inducible nitrate reductase [NADH] 2 OS=Glycine max GN=INR2 PE=2 SV=1 467 563 3.0E-13
sp|P11832|NIA1_ARATH Nitrate reductase [NADH] 1 OS=Arabidopsis thaliana GN=NIA1 PE=1 SV=3 467 563 4.0E-13
sp|Q0QF17|SDHA_MESAU Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial (Fragment) OS=Mesocricetus auratus GN=SDHA PE=1 SV=1 188 450 7.0E-13
sp|P54233|NIA1_SOYBN Inducible nitrate reductase [NADH] 1 OS=Glycine max GN=INR1 PE=2 SV=1 467 563 9.0E-13
sp|P36859|NIA_PETHY Nitrate reductase [NADH] OS=Petunia hybrida GN=NIA PE=2 SV=1 485 563 9.0E-13
sp|P47052|SDHX_YEAST Succinate dehydrogenase [ubiquinone] flavoprotein subunit 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJL045W PE=3 SV=1 4 453 1.0E-12
sp|P39867|NIA1_BRANA Nitrate reductase [NADH], clone PBNBR1405 OS=Brassica napus GN=NIA1 PE=2 SV=1 467 563 1.0E-12
sp|P39869|NIA_LOTJA Nitrate reductase [NADH] OS=Lotus japonicus GN=NIA PE=3 SV=1 467 563 2.0E-12
sp|P17570|NIA_SOLLC Nitrate reductase [NADH] OS=Solanum lycopersicum GN=NIA PE=3 SV=1 467 563 2.0E-12
sp|P49100|CYB5_ORYSJ Cytochrome b5 OS=Oryza sativa subsp. japonica GN=Os05g0108800 PE=2 SV=2 505 556 2.0E-12
sp|Q9ZWT2|CYB5D_ARATH Cytochrome B5 isoform D OS=Arabidopsis thaliana GN=CYTB5-D PE=1 SV=1 505 557 3.0E-12
sp|P08509|NIA2_TOBAC Nitrate reductase [NADH] 2 OS=Nicotiana tabacum GN=NIA2 PE=2 SV=2 485 563 3.0E-12
sp|O96099|FAD5B_DICDI Acyl-lipid (8-3)-desaturase B OS=Dictyostelium discoideum GN=fadB PE=1 SV=1 505 560 3.0E-12
sp|Q49617|NADB_MYCLE L-aspartate oxidase OS=Mycobacterium leprae (strain TN) GN=nadB PE=3 SV=2 217 441 4.0E-12
sp|P11605|NIA1_TOBAC Nitrate reductase [NADH] 1 OS=Nicotiana tabacum GN=NIA1 PE=3 SV=1 485 563 4.0E-12
sp|P27783|NIA_BETPN Nitrate reductase [NAD(P)H] OS=Betula pendula GN=NIA1 PE=2 SV=1 467 563 4.0E-12
sp|O04354|CYB5_BOROF Cytochrome b5 OS=Borago officinalis PE=2 SV=1 505 556 5.0E-12
sp|Q98AV8|NADB_RHILO L-aspartate oxidase OS=Rhizobium loti (strain MAFF303099) GN=nadB PE=3 SV=1 188 440 5.0E-12
sp|P11035|NIA2_ARATH Nitrate reductase [NADH] 2 OS=Arabidopsis thaliana GN=NIA2 PE=1 SV=1 474 563 5.0E-12
sp|Q59661|SDHA_PARDE Succinate dehydrogenase flavoprotein subunit OS=Paracoccus denitrificans GN=sdhA PE=3 SV=1 188 450 9.0E-12
sp|P49098|CYB5_TOBAC Cytochrome b5 OS=Nicotiana tabacum PE=2 SV=1 505 556 1.0E-11
sp|P39866|NIA2_PHAVU Nitrate reductase [NADH] 2 OS=Phaseolus vulgaris GN=NIA2 PE=3 SV=1 492 563 1.0E-11
sp|Q94AY1|NADB_ARATH L-aspartate oxidase, chloroplastic OS=Arabidopsis thaliana GN=AO PE=1 SV=1 6 448 1.0E-11
sp|Q9FDW8|CYB5A_ARATH Cytochrome b5 isoform A OS=Arabidopsis thaliana GN=CB5-A PE=1 SV=1 505 557 2.0E-11
sp|P39868|NIA2_BRANA Nitrate reductase [NADH], clone PBNBR1412 OS=Brassica napus GN=NIA2 PE=2 SV=1 492 563 2.0E-11
sp|Q9P5L0|CYB5_NEUCR Probable cytochrome b5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B23L21.190 PE=3 SV=2 502 557 3.0E-11
sp|P17571|NIA1_MAIZE Nitrate reductase [NADH] (Fragment) OS=Zea mays PE=1 SV=2 504 563 4.0E-11
sp|O48845|CYB5B_ARATH Cytochrome b5 isoform B OS=Arabidopsis thaliana GN=CYTB5-B PE=1 SV=1 505 556 5.0E-11
sp|P16081|NIA1_ORYSJ Nitrate reductase [NADH] 1 OS=Oryza sativa subsp. japonica GN=NIA1 PE=2 SV=3 467 563 5.0E-11
sp|Q01170|NIA_CHLVU Nitrate reductase [NADH] (Fragment) OS=Chlorella vulgaris PE=2 SV=1 505 563 5.0E-11
sp|Q9V4N3|CYB5_DROME Cytochrome b5 OS=Drosophila melanogaster GN=Cyt-b5 PE=2 SV=1 505 556 6.0E-11
sp|P49102|NIA3_MAIZE Nitrate reductase [NADH] 3 OS=Zea mays PE=3 SV=1 500 563 9.0E-11
sp|P27967|NIA1_HORVU Nitrate reductase [NADH] OS=Hordeum vulgare PE=3 SV=1 504 563 1.0E-10
sp|P27969|NIA2_HORVU Nitrate reductase [NADH] (Fragment) OS=Hordeum vulgare PE=2 SV=1 504 563 1.0E-10
sp|Q9Y1W0|FAD5A_DICDI Delta(5) fatty acid desaturase A OS=Dictyostelium discoideum GN=fadA PE=1 SV=1 504 560 1.0E-10
sp|P32953|CYBL_RHOGR (S)-mandelate dehydrogenase, mitochondrial OS=Rhodotorula graminis PE=1 SV=2 508 571 2.0E-10
sp|P49096|CYB5_MUSDO Cytochrome b5 OS=Musca domestica GN=Cyt-b5 PE=1 SV=1 505 556 2.0E-10
sp|P49099|CYB5S_TOBAC Cytochrome b5, seed isoform OS=Nicotiana tabacum PE=2 SV=1 505 556 2.0E-10
sp|Q8ZD80|NADB_YERPE L-aspartate oxidase OS=Yersinia pestis GN=nadB PE=3 SV=2 1 294 3.0E-10
sp|Q9Y706|CYB5_MORAP Cytochrome b5 OS=Mortierella alpina PE=1 SV=1 505 557 4.0E-10
sp|Q9CQX2|CYB5B_MOUSE Cytochrome b5 type B OS=Mus musculus GN=Cyb5b PE=1 SV=1 505 562 4.0E-10
sp|P04166|CYB5B_RAT Cytochrome b5 type B OS=Rattus norvegicus GN=Cyb5b PE=1 SV=2 487 562 4.0E-10
sp|P49097|CYB5_CUSRE Cytochrome b5 OS=Cuscuta reflexa PE=2 SV=1 502 557 4.0E-10
sp|P10902|NADB_ECOLI L-aspartate oxidase OS=Escherichia coli (strain K12) GN=nadB PE=1 SV=4 2 291 5.0E-10
sp|Q10352|YDAA_SCHPO Uncharacterized protein C1F12.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F12.10c PE=3 SV=1 506 560 7.0E-10
sp|Q9HFV1|CYB5_RHIST Cytochrome b5 OS=Rhizopus stolonifer PE=2 SV=1 505 557 9.0E-10
sp|P36841|NIA_VOLCA Nitrate reductase [NADH] OS=Volvox carteri GN=NITA PE=2 SV=1 504 563 9.0E-10
sp|Q874I5|CYB5_CANTR Cytochrome b5 OS=Candida tropicalis GN=Cytb5 PE=3 SV=1 505 557 1.0E-09
sp|O43169|CYB5B_HUMAN Cytochrome b5 type B OS=Homo sapiens GN=CYB5B PE=1 SV=2 505 557 2.0E-09
sp|Q42342|CYB5E_ARATH Cytochrome b5 isoform E OS=Arabidopsis thaliana GN=CYTB5-E PE=1 SV=2 506 556 2.0E-09
sp|Q9HNZ0|NADB_HALSA L-aspartate oxidase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=nadB PE=3 SV=1 4 455 2.0E-09
sp|Q8X0J4|CYB5L_NEUCR Putative cytochrome b5 B11H24.095 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B11H24.095 PE=3 SV=1 502 575 3.0E-09
sp|Q5RDJ5|CYB5B_PONAB Cytochrome b5 type B OS=Pongo abelii GN=CYB5B PE=2 SV=2 505 557 3.0E-09
sp|Q1ZXQ5|FAD5C_DICDI Probable Delta(5) fatty acid desaturase C OS=Dictyostelium discoideum GN=DDB_G0294553 PE=3 SV=1 505 566 3.0E-09
sp|P00168|CYB5_ALOSE Cytochrome b5 (Fragment) OS=Alouatta seniculus GN=CYB5A PE=1 SV=2 505 557 6.0E-09
sp|P40934|CYB5_BRAOB Cytochrome b5 OS=Brassica oleracea var. botrytis GN=CYB5 PE=1 SV=1 507 557 6.0E-09
sp|P00170|CYB5_HORSE Cytochrome b5 OS=Equus caballus GN=CYB5A PE=1 SV=3 505 556 7.0E-09
sp|P9WJJ9|NADB_MYCTU L-aspartate oxidase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=nadB PE=1 SV=1 111 441 9.0E-09
sp|P9WJJ8|NADB_MYCTO L-aspartate oxidase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=nadB PE=3 SV=1 111 441 9.0E-09
sp|P65500|NADB_MYCBO L-aspartate oxidase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=nadB PE=3 SV=1 111 441 9.0E-09
sp|P00174|CYB5_CHICK Cytochrome b5 OS=Gallus gallus GN=CYB5A PE=1 SV=4 505 557 1.0E-08
sp|P00172|CYB5_PIG Cytochrome b5 OS=Sus scrofa GN=CYB5A PE=1 SV=3 505 556 1.0E-08
sp|A9SIZ6|D5FAD_PHYPA Acyl-lipid (8-3)-desaturase OS=Physcomitrella patens subsp. patens GN=DES5 PE=1 SV=1 491 576 1.0E-08
sp|P00171|CYB5_BOVIN Cytochrome b5 OS=Bos taurus GN=CYB5A PE=1 SV=3 505 556 1.0E-08
sp|P00167|CYB5_HUMAN Cytochrome b5 OS=Homo sapiens GN=CYB5A PE=1 SV=2 505 556 2.0E-08
sp|P00169|CYB5_RABIT Cytochrome b5 OS=Oryctolagus cuniculus GN=CYB5A PE=1 SV=4 505 556 2.0E-08
sp|Q28CZ9|NB5R4_XENTR Cytochrome b5 reductase 4 OS=Xenopus tropicalis GN=cyb5r4 PE=2 SV=1 506 576 2.0E-08
sp|Q4R749|FADS2_MACFA Fatty acid desaturase 2 OS=Macaca fascicularis GN=FADS2 PE=2 SV=1 505 576 2.0E-08
sp|Q9USM6|CYB52_SCHPO Probable cytochrome b5 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=oca8 PE=3 SV=1 506 557 3.0E-08
sp|P40312|CYB5_YEAST Cytochrome b5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYB5 PE=1 SV=2 505 556 3.0E-08
sp|O74212|D5FAD_MORAP Acyl-lipid (8-3)-desaturase OS=Mortierella alpina GN=DES1 PE=1 SV=1 497 560 4.0E-08
sp|Q9ZNV4|CYB5C_ARATH Cytochrome B5 isoform C OS=Arabidopsis thaliana GN=CYTB5-C PE=1 SV=1 506 589 4.0E-08
sp|A4UVI1|FADS1_PAPAN Fatty acid desaturase 1 OS=Papio anubis GN=FADS1 PE=1 SV=1 489 576 5.0E-08
sp|P00173|CYB5_RAT Cytochrome b5 OS=Rattus norvegicus GN=Cyb5a PE=1 SV=2 505 557 5.0E-08
sp|Q9DEX7|FADS2_DANRE Fatty acid desaturase 2 OS=Danio rerio GN=fads2 PE=2 SV=1 505 576 6.0E-08
sp|P56395|CYB5_MOUSE Cytochrome b5 OS=Mus musculus GN=Cyb5a PE=1 SV=2 505 557 6.0E-08
sp|Q5REA7|FADS2_PONAB Fatty acid desaturase 2 OS=Pongo abelii GN=FADS2 PE=2 SV=1 505 576 9.0E-08
sp|Q6DDK2|FADS2_XENLA Fatty acid desaturase 2 OS=Xenopus laevis GN=fads2 PE=2 SV=1 503 567 9.0E-08
sp|O95864|FADS2_HUMAN Fatty acid desaturase 2 OS=Homo sapiens GN=FADS2 PE=1 SV=1 505 576 1.0E-07
sp|Q7L1T6|NB5R4_HUMAN Cytochrome b5 reductase 4 OS=Homo sapiens GN=CYB5R4 PE=1 SV=1 504 560 1.0E-07
sp|A0R4H4|Y5835_MYCS2 KsdD-like steroid dehydrogenase MSMEG_5835 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=MSMEG_5835 PE=1 SV=1 2 284 1.0E-07
sp|Q28ED0|SDHA_XENTR Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Xenopus tropicalis GN=sdha PE=2 SV=1 391 450 1.0E-07
sp|Q68EJ0|NB5R4_RAT Cytochrome b5 reductase 4 OS=Rattus norvegicus GN=Cyb5r4 PE=1 SV=2 504 560 1.0E-07
sp|O22704|CYP5F_ARATH Cytochrome B5-like protein OS=Arabidopsis thaliana GN=CB5LP PE=2 SV=1 505 556 2.0E-07
sp|Q3EBF7|SLD2_ARATH Delta(8)-fatty-acid desaturase 2 OS=Arabidopsis thaliana GN=SLD2 PE=1 SV=1 506 560 3.0E-07
sp|O74875|YJ83_SCHPO Uncharacterized heme-binding protein C330.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC330.03c PE=1 SV=1 490 561 3.0E-07
sp|Q32LH7|NB5R4_BOVIN Cytochrome b5 reductase 4 OS=Bos taurus GN=CYB5R4 PE=2 SV=1 504 560 3.0E-07
sp|P31039|SDHA_BOVIN Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Bos taurus GN=SDHA PE=1 SV=3 391 450 4.0E-07
sp|Q3TDX8|NB5R4_MOUSE Cytochrome b5 reductase 4 OS=Mus musculus GN=Cyb5r4 PE=2 SV=3 504 560 4.0E-07
sp|P82291|CYB5_ECTSH Soluble cytochrome b558 OS=Ectothiorhodospira shaposhnikovii PE=1 SV=2 505 556 4.0E-07
sp|Q0VAX3|FS2P1_MOUSE Fatty acid desaturase 2-like protein FADS2P1 OS=Mus musculus GN=Fads2p1 PE=2 SV=1 505 576 4.0E-07
sp|P39864|NIA_PHYIN Nitrate reductase [NADPH] OS=Phytophthora infestans GN=NIAA PE=3 SV=1 509 563 5.0E-07
sp|O60427|FADS1_HUMAN Fatty acid desaturase 1 OS=Homo sapiens GN=FADS1 PE=1 SV=3 489 576 5.0E-07
sp|Q9Z0R9|FADS2_MOUSE Fatty acid desaturase 2 OS=Mus musculus GN=Fads2 PE=1 SV=1 505 576 8.0E-07
sp|Q9Z122|FADS2_RAT Fatty acid desaturase 2 OS=Rattus norvegicus GN=Fads2 PE=2 SV=1 505 576 8.0E-07
sp|A4FV48|FADS2_BOVIN Fatty acid desaturase 2 OS=Bos taurus GN=FADS2 PE=2 SV=1 505 576 1.0E-06
sp|O94391|CYB51_SCHPO Probable cytochrome b5 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC29A10.16c PE=3 SV=1 509 556 1.0E-06
sp|Q59327|OASD_COMTE 3-oxo-5-alpha-steroid 4-dehydrogenase OS=Comamonas testosteroni PE=1 SV=1 205 423 1.0E-06
sp|Q8S3C0|D4FAD_THRSP Acyl-lipid (7-3)-desaturase OS=Thraustochytrium sp. GN=Fad4 PE=1 SV=1 504 578 2.0E-06
sp|Q05531|NIA_USTMA Nitrate reductase [NADPH] OS=Ustilago maydis (strain 521 / FGSC 9021) GN=NAR1 PE=2 SV=2 449 560 2.0E-06
sp|Q9ZRP7|SLD1_ARATH Delta(8)-fatty-acid desaturase 1 OS=Arabidopsis thaliana GN=SLD1 PE=1 SV=1 509 560 6.0E-06
sp|Q9FR82|SLD1_BOROF Delta(8)-fatty-acid desaturase OS=Borago officinalis GN=sld1 PE=1 SV=1 506 560 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006508 proteolysis Yes
GO:0070573 metallodipeptidase activity Yes
GO:0016491 oxidoreductase activity Yes
GO:0140096 catalytic activity, acting on a protein No
GO:1901564 organonitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0008235 metalloexopeptidase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0016787 hydrolase activity No
GO:0044238 primary metabolic process No
GO:0019538 protein metabolic process No
GO:0008238 exopeptidase activity No
GO:0071704 organic substance metabolic process No
GO:0016805 dipeptidase activity No
GO:0008237 metallopeptidase activity No
GO:0003824 catalytic activity No
GO:0043170 macromolecule metabolic process No
GO:0008150 biological_process No
GO:0008233 peptidase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|579950
MAQVIVVGGGLAGLSAAHTVLERGGNVLVLDKQPFMGGNSTKATSGINGAGTQPQQDAGIADSARIFFEDTKKSA
RELARDDLIQVLTGRSADAVHWLQSKFGLDLTKVARLGGHSQPRTHRGGAQFPGMVITYAQLERLEDLSVSDPER
VKVIKKARVTKLVKDSSGAVVGVEYECGGKTETAYGPVILATGGYAADFTGDSLLKKYRPEYYELPTTNGEHSTG
DGHKLALSIGASAIDLEKVQVHPTGLVDPKEPDAKVKFLAAEALRGVGGLLLDNTGKRFVDELQHRDYVTGKMWE
NGKYPIRLVLNGKASKDIEWHCKHYVGRGLMKRFDSGEALAKEFGLAPEVLKKTFEDYNVSVRTQKDPFGKKFFQ
GEWKFDDFFHVAVMTPVLHYTMGGLEIDAESRIIDQSGKPIPGLFAAGEVAGGVHGANRLGGSSLLGCVVFGRVS
GDSASAYLLQATSAAVQKAGGRLGALAGHISGSTAASTPDSAAAAPVGKSASGEYTLADVAKHNKKDDIWVVIDG
QVLDVTKFLPDHPGGEKAIILYAGRDATEEFNMLHDPKVIPRYAPDAVIGKHRQLLEPGNVYVPHTIEAFVLTRE
DPTLLSAAAYPLPHTLDDSEVSQGFLRRLESMPTTPDHLNVGYIGNEASPLLRSDSSAQASSPRDTNTMARKIVW
TGLTLLFVAALVFFLGFADLLSDELSPWIGTLPNDPHKAALAIMKQAPVIDGHIDLPYLVRLAYGNNVSAVDLET
RMPGHVDIPRLRKGRVGGFFWSAYVGCANPEEEGKDFTDATWIVRDTLEQIDVARELIAKYPDTFQLTTTSREVE
VAISNGKIASLIGIEGAHQLGNSIAALRQYYALGVRYVTLTHICHNAFADSCGYLPGIKPLHHGLSSFGRLLIDE
MNRLGVLVDLSHTSDDTASQAILYSKAPVIWSHSSAREVHDVPRNVPDKVLRLIGKAENQNDAVVMVNFSPFFIA
DEGMANVQAVADHVEHIANITGKAHVGIGSDFDGIGDTPTGLEDVSKYPDLIAELITRGWNKVEIAGLTGDNLLR
ILKGAEKTARHMQAVGTAPIYDLYPKRPDLPLRQDDL*
Coding >Agabi119p4|579950
ATGGCACAAGTCATTGTTGTCGGTGGCGGTCTCGCTGGGCTCTCTGCTGCTCACACTGTTCTCGAACGTGGTGGT
AATGTCCTCGTCCTCGACAAACAACCTTTCATGGGTGGAAACTCTACAAAAGCCACCTCTGGTATAAACGGCGCT
GGTACTCAGCCCCAGCAAGATGCTGGCATAGCCGATTCCGCAAGGATATTCTTCGAAGATACCAAAAAATCTGCT
CGTGAACTTGCTCGCGATGATTTGATTCAAGTCCTCACGGGTCGCTCCGCTGATGCAGTCCACTGGCTACAGAGC
AAGTTCGGCCTTGACCTGACCAAAGTCGCAAGGCTAGGTGGCCACAGCCAGCCCCGCACACACCGTGGTGGTGCT
CAATTCCCTGGGATGGTCATTACCTACGCACAACTTGAGCGCCTTGAGGACCTTTCCGTTAGCGATCCCGAGCGT
GTCAAGGTGATTAAGAAAGCTCGTGTAACCAAGCTTGTGAAAGACAGCTCTGGCGCTGTCGTTGGGGTGGAATAT
GAATGCGGTGGTAAGACCGAGACTGCGTATGGCCCCGTTATCCTTGCTACCGGTGGTTACGCTGCGGACTTTACC
GGAGATTCGCTTCTTAAAAAGTACCGCCCAGAGTACTACGAATTGCCTACAACCAACGGCGAGCATTCCACAGGT
GATGGTCACAAACTTGCGCTATCGATCGGTGCAAGTGCTATCGACCTTGAGAAGGTTCAAGTTCACCCTACGGGT
TTAGTTGACCCCAAGGAACCCGATGCCAAGGTCAAGTTTTTGGCTGCCGAGGCTCTTCGAGGTGTTGGTGGTCTT
CTGCTTGACAACACGGGCAAGCGGTTCGTCGACGAGCTTCAGCACCGTGATTATGTAACGGGCAAAATGTGGGAG
AACGGCAAATATCCCATCCGCCTTGTTCTCAATGGCAAGGCTTCCAAGGATATCGAGTGGCATTGCAAACACTAT
GTTGGCCGTGGTCTTATGAAACGCTTCGATAGTGGTGAAGCACTTGCCAAAGAATTCGGACTTGCTCCCGAGGTC
CTCAAAAAGACTTTCGAGGACTATAATGTCTCAGTCCGTACTCAAAAGGATCCCTTCGGCAAGAAGTTCTTCCAA
GGCGAATGGAAGTTTGATGACTTCTTCCATGTTGCTGTTATGACCCCTGTCCTCCACTACACCATGGGTGGTCTC
GAGATCGACGCTGAATCTCGCATCATTGACCAGTCCGGCAAGCCGATCCCAGGCCTGTTTGCTGCGGGTGAGGTT
GCTGGAGGTGTTCATGGTGCCAACCGTCTTGGTGGTTCTTCCCTCCTCGGTTGTGTCGTTTTCGGTCGTGTATCC
GGTGACAGTGCTTCTGCCTACCTCCTCCAGGCCACATCTGCTGCCGTGCAAAAGGCTGGTGGTCGTCTAGGTGCA
CTTGCTGGCCACATTTCTGGTTCTACTGCAGCCTCTACCCCCGACTCTGCCGCTGCCGCTCCTGTAGGGAAAAGC
GCCTCTGGCGAGTACACTCTTGCAGATGTCGCCAAACATAACAAGAAAGATGACATTTGGGTGGTCATTGATGGC
CAGGTCCTCGATGTCACCAAATTCCTTCCTGACCACCCGGGAGGTGAGAAAGCCATCATCCTCTATGCAGGTCGC
GACGCTACAGAGGAATTCAACATGCTTCATGACCCCAAAGTCATTCCACGATATGCGCCTGATGCTGTCATCGGC
AAGCATCGGCAATTATTAGAGCCTGGCAATGTGTATGTGCCTCATACTATCGAGGCTTTCGTGCTGACGCGCGAA
GACCCAACATTGTTGTCGGCTGCTGCGTATCCTCTCCCCCACACGTTAGACGATTCAGAAGTGTCGCAAGGCTTT
CTGCGCCGTTTAGAATCTATGCCCACGACGCCGGATCATCTCAACGTTGGATACATTGGGAATGAAGCGTCACCT
CTTTTACGGAGTGACAGCAGTGCCCAAGCATCCTCACCAAGAGACACGAACACAATGGCGAGGAAGATAGTATGG
ACCGGTCTCACACTGCTCTTTGTCGCCGCACTGGTGTTTTTCCTGGGTTTCGCGGACTTGCTTAGTGACGAACTT
TCCCCATGGATCGGAACGCTGCCAAACGACCCTCACAAAGCTGCACTAGCCATTATGAAGCAGGCGCCCGTGATT
GATGGACATATCGATTTACCCTATCTTGTTCGCTTGGCGTACGGAAACAACGTTTCTGCGGTCGACCTCGAAACC
CGAATGCCTGGGCATGTCGACATACCCAGGCTAAGAAAAGGGCGAGTTGGAGGATTTTTCTGGTCTGCGTATGTT
GGCTGCGCAAACCCTGAAGAAGAGGGTAAAGACTTTACTGATGCGACCTGGATTGTGAGGGACACTCTTGAACAA
ATTGATGTAGCACGGGAGCTAATTGCCAAGTATCCGGATACATTCCAACTCACGACAACATCTCGCGAAGTTGAG
GTCGCAATATCTAATGGCAAGATTGCTAGTCTGATTGGCATCGAAGGTGCACACCAGCTCGGCAATTCGATTGCT
GCACTCCGCCAATACTATGCGCTAGGCGTGCGCTATGTGACCCTGACGCATATCTGCCACAATGCGTTTGCAGAT
TCTTGTGGTTACTTGCCAGGTATAAAGCCCTTGCATCACGGTTTAAGCTCTTTTGGTAGATTGCTCATCGACGAG
ATGAACCGGTTGGGCGTTCTCGTCGACCTGTCGCATACGTCAGATGACACCGCATCTCAAGCCATCTTGTATTCA
AAGGCTCCAGTCATCTGGTCTCATTCATCTGCTCGAGAGGTCCACGATGTCCCGCGAAACGTCCCTGATAAAGTG
CTGAGGCTTATCGGTAAAGCGGAAAACCAGAACGATGCAGTTGTCATGGTCAATTTTTCTCCTTTCTTCATTGCT
GATGAAGGAATGGCCAATGTTCAAGCGGTTGCAGATCATGTTGAACATATAGCCAATATAACGGGTAAAGCTCAT
GTAGGTATCGGCAGCGATTTCGACGGTATTGGAGATACACCCACGGGACTCGAAGACGTCTCGAAGTATCCCGAT
TTGATTGCAGAATTGATAACGAGAGGTTGGAACAAGGTCGAGATCGCCGGACTTACTGGTGACAACCTGCTCCGT
ATTTTAAAGGGGGCGGAGAAAACTGCAAGGCATATGCAAGCTGTGGGCACTGCTCCCATCTATGATCTTTACCCC
AAGAGACCAGACCTTCCCCTTCGACAAGATGACTTATGA
Transcript >Agabi119p4|579950
ATGGCACAAGTCATTGTTGTCGGTGGCGGTCTCGCTGGGCTCTCTGCTGCTCACACTGTTCTCGAACGTGGTGGT
AATGTCCTCGTCCTCGACAAACAACCTTTCATGGGTGGAAACTCTACAAAAGCCACCTCTGGTATAAACGGCGCT
GGTACTCAGCCCCAGCAAGATGCTGGCATAGCCGATTCCGCAAGGATATTCTTCGAAGATACCAAAAAATCTGCT
CGTGAACTTGCTCGCGATGATTTGATTCAAGTCCTCACGGGTCGCTCCGCTGATGCAGTCCACTGGCTACAGAGC
AAGTTCGGCCTTGACCTGACCAAAGTCGCAAGGCTAGGTGGCCACAGCCAGCCCCGCACACACCGTGGTGGTGCT
CAATTCCCTGGGATGGTCATTACCTACGCACAACTTGAGCGCCTTGAGGACCTTTCCGTTAGCGATCCCGAGCGT
GTCAAGGTGATTAAGAAAGCTCGTGTAACCAAGCTTGTGAAAGACAGCTCTGGCGCTGTCGTTGGGGTGGAATAT
GAATGCGGTGGTAAGACCGAGACTGCGTATGGCCCCGTTATCCTTGCTACCGGTGGTTACGCTGCGGACTTTACC
GGAGATTCGCTTCTTAAAAAGTACCGCCCAGAGTACTACGAATTGCCTACAACCAACGGCGAGCATTCCACAGGT
GATGGTCACAAACTTGCGCTATCGATCGGTGCAAGTGCTATCGACCTTGAGAAGGTTCAAGTTCACCCTACGGGT
TTAGTTGACCCCAAGGAACCCGATGCCAAGGTCAAGTTTTTGGCTGCCGAGGCTCTTCGAGGTGTTGGTGGTCTT
CTGCTTGACAACACGGGCAAGCGGTTCGTCGACGAGCTTCAGCACCGTGATTATGTAACGGGCAAAATGTGGGAG
AACGGCAAATATCCCATCCGCCTTGTTCTCAATGGCAAGGCTTCCAAGGATATCGAGTGGCATTGCAAACACTAT
GTTGGCCGTGGTCTTATGAAACGCTTCGATAGTGGTGAAGCACTTGCCAAAGAATTCGGACTTGCTCCCGAGGTC
CTCAAAAAGACTTTCGAGGACTATAATGTCTCAGTCCGTACTCAAAAGGATCCCTTCGGCAAGAAGTTCTTCCAA
GGCGAATGGAAGTTTGATGACTTCTTCCATGTTGCTGTTATGACCCCTGTCCTCCACTACACCATGGGTGGTCTC
GAGATCGACGCTGAATCTCGCATCATTGACCAGTCCGGCAAGCCGATCCCAGGCCTGTTTGCTGCGGGTGAGGTT
GCTGGAGGTGTTCATGGTGCCAACCGTCTTGGTGGTTCTTCCCTCCTCGGTTGTGTCGTTTTCGGTCGTGTATCC
GGTGACAGTGCTTCTGCCTACCTCCTCCAGGCCACATCTGCTGCCGTGCAAAAGGCTGGTGGTCGTCTAGGTGCA
CTTGCTGGCCACATTTCTGGTTCTACTGCAGCCTCTACCCCCGACTCTGCCGCTGCCGCTCCTGTAGGGAAAAGC
GCCTCTGGCGAGTACACTCTTGCAGATGTCGCCAAACATAACAAGAAAGATGACATTTGGGTGGTCATTGATGGC
CAGGTCCTCGATGTCACCAAATTCCTTCCTGACCACCCGGGAGGTGAGAAAGCCATCATCCTCTATGCAGGTCGC
GACGCTACAGAGGAATTCAACATGCTTCATGACCCCAAAGTCATTCCACGATATGCGCCTGATGCTGTCATCGGC
AAGCATCGGCAATTATTAGAGCCTGGCAATGTGTATGTGCCTCATACTATCGAGGCTTTCGTGCTGACGCGCGAA
GACCCAACATTGTTGTCGGCTGCTGCGTATCCTCTCCCCCACACGTTAGACGATTCAGAAGTGTCGCAAGGCTTT
CTGCGCCGTTTAGAATCTATGCCCACGACGCCGGATCATCTCAACGTTGGATACATTGGGAATGAAGCGTCACCT
CTTTTACGGAGTGACAGCAGTGCCCAAGCATCCTCACCAAGAGACACGAACACAATGGCGAGGAAGATAGTATGG
ACCGGTCTCACACTGCTCTTTGTCGCCGCACTGGTGTTTTTCCTGGGTTTCGCGGACTTGCTTAGTGACGAACTT
TCCCCATGGATCGGAACGCTGCCAAACGACCCTCACAAAGCTGCACTAGCCATTATGAAGCAGGCGCCCGTGATT
GATGGACATATCGATTTACCCTATCTTGTTCGCTTGGCGTACGGAAACAACGTTTCTGCGGTCGACCTCGAAACC
CGAATGCCTGGGCATGTCGACATACCCAGGCTAAGAAAAGGGCGAGTTGGAGGATTTTTCTGGTCTGCGTATGTT
GGCTGCGCAAACCCTGAAGAAGAGGGTAAAGACTTTACTGATGCGACCTGGATTGTGAGGGACACTCTTGAACAA
ATTGATGTAGCACGGGAGCTAATTGCCAAGTATCCGGATACATTCCAACTCACGACAACATCTCGCGAAGTTGAG
GTCGCAATATCTAATGGCAAGATTGCTAGTCTGATTGGCATCGAAGGTGCACACCAGCTCGGCAATTCGATTGCT
GCACTCCGCCAATACTATGCGCTAGGCGTGCGCTATGTGACCCTGACGCATATCTGCCACAATGCGTTTGCAGAT
TCTTGTGGTTACTTGCCAGGTATAAAGCCCTTGCATCACGGTTTAAGCTCTTTTGGTAGATTGCTCATCGACGAG
ATGAACCGGTTGGGCGTTCTCGTCGACCTGTCGCATACGTCAGATGACACCGCATCTCAAGCCATCTTGTATTCA
AAGGCTCCAGTCATCTGGTCTCATTCATCTGCTCGAGAGGTCCACGATGTCCCGCGAAACGTCCCTGATAAAGTG
CTGAGGCTTATCGGTAAAGCGGAAAACCAGAACGATGCAGTTGTCATGGTCAATTTTTCTCCTTTCTTCATTGCT
GATGAAGGAATGGCCAATGTTCAAGCGGTTGCAGATCATGTTGAACATATAGCCAATATAACGGGTAAAGCTCAT
GTAGGTATCGGCAGCGATTTCGACGGTATTGGAGATACACCCACGGGACTCGAAGACGTCTCGAAGTATCCCGAT
TTGATTGCAGAATTGATAACGAGAGGTTGGAACAAGGTCGAGATCGCCGGACTTACTGGTGACAACCTGCTCCGT
ATTTTAAAGGGGGCGGAGAAAACTGCAAGGCATATGCAAGCTGTGGGCACTGCTCCCATCTATGATCTTTACCCC
AAGAGACCAGACCTTCCCCTTCGACAAGATGACTTATGA
Gene >Agabi119p4|579950
ATGGCACAAGTCATTGTTGTCGGTGGCGGTCTCGCTGGGCTCTCTGCTGCTCACACTGTTCTCGAACGTGGTGGT
AATGTCCTCGTCCTCGACAAACAACCGTATGTTACCCTTGCCCCTTTCCTTGTGTTCCAACACTTTTGCTTTTCT
CTAGTTTCATGGGTGGAAACTCTACAAAAGCCACCTCTGGTATAAACGGCGCTGGTACTCAGCCCCAGCAAGATG
CTGGCATAGCCGATTCCGCAAGGATATTCTTCGAAGATACCAAAAAATCTGTAAATACCCGAAAAATCACATGTC
CCTTATCCGAACTCAGACCGCTATTATAGGCTCGTGAACTTGCTCGCGATGATTTGATTCAAGTCCTCACGGGTC
GCTCCGCTGATGCAGTCCACTGGCTACAGAGCAAGTTCGGCCTTGACCTGACCAAAGTCGCAAGGCTAGGTGGCC
ACAGCCAGCCCCGCACACACCGTGGTGGTGCTCAATTCCCTGGGATGGTATGTCCACTTTTCTTCCCCTTTACCC
CGCACAACTCCGCTTTCCACATCGATTTTAAATCCGCTGCGTTTATGCCGTTCCGCATCCCGAATATTCACACAC
TTTTTCATTCTCCTTCAGGTCATTACCTACGCACAACTTGAGCGCCTTGAGGACCTTTCCGTTAGCGATCCCGAG
CGTGTCAAGGTGATTAAGAAAGCTCGTGTAACCAAGCTTGTGAAAGACAGCTCTGGCGCTGTCGTTGGGGTGGAA
TATGAATGCGGTGGTAAGACCGAGACTGCGTATGGCCCCGTTATCCTTGCTACCGGTGGTTACGCTGCGGACTTT
ACCGGAGATTCGCTTCTTAAAAAGTACCGCCCAGAGTACTACGAATTGCCTACAACCAACGGCGAGCATTCCACA
GGTGATGGTCACAAACTTGCGCTATCGATCGGTGCAAGTGCTATCGACCTTGAGAAGGTTCAAGTTCACCCTACG
GGTTTAGTTGACCCCAAGGAACCCGATGCCAAGGTCAAGTTTTTGGCTGCCGAGGCTCTTCGAGGTGTTGGTGGT
CTTCTGCTTGACAACACGGGCAAGCGGTTCGTCGACGAGCTTCAGCACCGTGATTATGTAACGGGCAAAATGTGG
GAGAACGGCAAATATCCCATCCGCCTTGTTCTCAATGGCAAGGCTTCCAAGGATATCGAGTGGCATTGCAAACAC
TATGTTGGCCGTGGTCTTATGAAACGCTTCGATAGTGGTGAAGCACTTGCCAAAGAATTCGGACTTGCTCCCGAG
GTCCTCAAAAAGACTTTCGAGGACTATAATGTCTCAGTCCGTACTCAAAAGGATCCCTTCGGCAAGAAGGTGCGC
GCCTCTTCTGTGCTCATTGATTTCCAATTTAAATTCACCTTTCGCTTAGTTCTTCCAAGGCGAATGGAAGTTTGA
TGACTTCTTCCATGTTGCTGTTATGACCCCTGTCCTCCACTACACCATGGGTGGTCTCGAGATCGACGCTGAATC
TCGCATCATTGACCAGTCCGGCAAGCCGATCCCAGGCCTGTTTGCTGCGGGTGAGGTTGCTGGAGGTGTTCATGG
TGCCAACCGTCTTGGTGGTTCTTCCCTCCTCGGTTGTGTCGTTTTCGGTCGTGTATCCGGTGACAGTGCTTCTGC
CTACCTCCTCCAGGCCACATCTGCTGCCGTGCAAAAGGCTGGTGGTCGTCTAGGTGCACTTGCTGGCCACATTTC
TGGTTCTACTGCAGCCTCTACCCCCGACTCTGCCGCTGCCGCTCCTGTAGGGAAAAGCGCCTCTGGCGAGTACAC
TCTTGCAGATGTCGCCAAACATAACAAGAAAGATGACATTTGGGTGGTCATTGATGGCCAGGTCCTCGATGTCAC
CAAATTCCTTCCTGACCACCCGGGAGGTGAGAAAGCCATCATCCTCTATGCAGGTCGCGACGCTACAGAGGAATT
CAACATGCTTCATGACCCCAAAGTCATTCCACGATATGCGCCTGATGCTGTCATCGGCAAGGTGAAGGCATGAGT
ATAGGAATAATACTGTATAGACTAAATTTCGTCGTATTACCACTGCATTTCCATTATCTATATCAAGCTCATGTT
TGTTTGCTTTTCGCCCTGTCGAATAATGTATATTATTGGTTTCCCTTGTATCGTCTATGCTTTCGCTTAGCATCG
GCAATTATTAGAGCCTGGCAATGTGTATGTGCCTCATACTATCGAGGCTTTCGTGCTGACGCGCGAAGAGTGCGA
ATTCCCATGTTACGGTCAGTCAGTTACATATTTGCTTTCCTTATGCTATTTACAGCCCAACATTGTTGTCGGCTG
CTGCGTATCCTCTCCCCCACACGTTAGACGGTTAGTATTCCCCCGCACTCACCAGCCATTGTACAATTTGTACCT
TCACTGAGATCCACTGTTGGTCCCAGATTCAGAAGTGTCGCAAGGCTTTCTGCGCCGTTTAGAATCGTACAAGTC
GCATCTCGTACGACCTTGAAATTTTCAGAAAATACTGACACAGTATGCCCACGACGCCGGATCATCTCAACGTTG
GATACATTGGGAATGAAGCGTCACCTCTTTTACGGAGTGACAGCAGTGCCCAAGCATCCTCACCAAGAGACACGA
ACACAATGGCGAGGAAGATAGTATGGACCGGTCTCACACTGCTCTTTGTCGCCGCACTGGTGTTTTTCCTGGGTT
TCGCGGACTTGCTTAGTGACGAACTTTCCCCATGGATCGGAACGCTGCCAAACGACCCTCACAAAGCTGCACTAG
CCATTATGAAGCAGGCGCCCGTGATTGTACGTGCTTTCTTGTCTTCGGTTCTGGTGGCATTGACATTGGATGCAA
GGATGGACATATCGGTTAGCGAGCTTTTGAGTGGGGAGACTTAACCGACATATTGATAGGAGTTGCATTGTAGAT
TTACCCTATCTTGTTCGCTTGGCGTACGGAAACAACGTTTCTGCGGTCGACCTCGAAACCCGAATGCCTGGGCAT
GTCGACATACCCAGGCTAAGAAAAGGGCGAGTTGGAGGATTTTTCTGGTGCGTCTTCCCGTCCTGATCTCCCCAA
TAACGACGCCAACATTGTGATATAGGTCTGCGTATGTTGGCTGCGCAAACCCTGAAGAAGAGGGTAAAGACTTTA
CTGATGCGACCTGGATTGTGAGGTTTGTGGGAAACCGTTCGAGGCCGAGCCGGTGCTAAACCATTCCGCTCGTAC
TTAGGGACACTCTTGAACAAATTGATGTAGCACGGGAGCTAATTGCCAAGTATCCGGATGTAAGCCGCTTAGAGC
ATCTGGTTGATTGTGGGCTCCCACTGATGAAAATGGATTTTAGACATTCCAACTCACGACAACATCTCGCGAAGT
TGAGGTCGCAATATCTAATGGCAAGATTGCTAGTCTGATTGGCATCGAAGGGTACGCACTCACAAGCTCTGGGAA
ATGTATCTCTTCTTTTATACATATTTAGTGCACACCAGCTCGGCAATTCGATTGCTGCACTCCGCCAATACTATG
CGCTAGGCGTGCGCTATGTGACCCTGACGCATATCTGCCACAATGCGTTTGCAGATTCTTGTGGTTACTTGCCAG
GTATAAAGCCCTTGCATCACGGTTTAAGGTAGGACACTGTGATTCACTTGTTTGAGAAATAAATTTGACGGTCTT
TTCAGCTCTTTTGGTAGATTGCTCATCGACGAGATGAACCGGTTGGGCGTTCTCGTCGACCTGTCGCATACGTCA
GATGACACCGCATCTCAAGCCATCTTGTATTCAAAGGCTCCAGTCATCTGGTCTCATTCATCTGCTCGAGAGGTC
CACGATGTCCCGCGAAACGTCCCTGATAAAGTGCTGAGGCTTATCGGTAAAGCGGAAAACCAGAACGATGCAGTT
GTCATGGTATGTAGCTTGATTTATGTTACAGAATGCGGTGATGATGGCGTCCTAGGTCAATTTTTCTCCTTTCTT
CATTGCTGATGAAGGAATGGCCAATGTTCAAGCGGTTGCAGATCATGTTGAACATATAGCCAATATAACGGGTAA
AGCTCAGTGAGTGCCTATCAATTCAGACTATGCCATCGTAGTTAATCACTCTGCTTGTCTCTAGTGTAGGTATCG
GCAGCGATTTCGACGGTATTGGAGATACACCCACGGGACTCGAAGACGTCTCGAAGTATCCCGATTTGGTTCGTC
ATTTAATAAAGTGTCTTGTAGGATGGTCCTAATGCATTGTGGCAGATTGCAGAATTGATAACGAGAGGTTGGAAC
AAGGTCGAGATCGCCGGACTTACTGGTGACAACCTGCTCCGTATTTTAAAGGGGGCGGAGAAAACTGCAAGGCAT
ATGCAAGCTGTGGGCACTGCTCCCATCTATGATCTTTACCCCAAGAGACCAGACCTTCCCCTTCGACAAGATGAC
TTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail