Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|579800
Gene name
Locationscaffold_02:1121486..1122419
Strand+
Gene length (bp)933
Transcript length (bp)663
Coding sequence length (bp)663
Protein length (aa) 221

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01521 Fe-S_biosyn Iron-sulphur cluster biosynthesis 3.2E-07 89 172

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O43045|ISA2_SCHPO Iron-sulfur assembly protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isa2 PE=3 SV=1 69 182 7.0E-12
sp|Q1QES5|ERPA_PSYCK Iron-sulfur cluster insertion protein ErpA OS=Psychrobacter cryohalolentis (strain K5) GN=erpA PE=3 SV=1 84 166 8.0E-11
sp|Q4FVP8|ERPA_PSYA2 Iron-sulfur cluster insertion protein ErpA OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=erpA PE=3 SV=1 84 166 8.0E-11
sp|Q54P40|ISCA2_DICDI Iron-sulfur cluster assembly 2 homolog, mitochondrial OS=Dictyostelium discoideum GN=isca2 PE=3 SV=1 74 167 2.0E-10
sp|O67709|Y1857_AQUAE Protein aq_1857 OS=Aquifex aeolicus (strain VF5) GN=aq_1857 PE=1 SV=1 87 179 5.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O43045|ISA2_SCHPO Iron-sulfur assembly protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isa2 PE=3 SV=1 69 182 7.0E-12
sp|Q1QES5|ERPA_PSYCK Iron-sulfur cluster insertion protein ErpA OS=Psychrobacter cryohalolentis (strain K5) GN=erpA PE=3 SV=1 84 166 8.0E-11
sp|Q4FVP8|ERPA_PSYA2 Iron-sulfur cluster insertion protein ErpA OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=erpA PE=3 SV=1 84 166 8.0E-11
sp|Q54P40|ISCA2_DICDI Iron-sulfur cluster assembly 2 homolog, mitochondrial OS=Dictyostelium discoideum GN=isca2 PE=3 SV=1 74 167 2.0E-10
sp|O67709|Y1857_AQUAE Protein aq_1857 OS=Aquifex aeolicus (strain VF5) GN=aq_1857 PE=1 SV=1 87 179 5.0E-10
sp|Q9ZE83|Y063_RICPR Uncharacterized protein RP063 OS=Rickettsia prowazekii (strain Madrid E) GN=RP063 PE=3 SV=1 88 163 2.0E-09
sp|B0VML0|ERPA_ACIBS Iron-sulfur cluster insertion protein ErpA OS=Acinetobacter baumannii (strain SDF) GN=erpA PE=3 SV=1 90 167 6.0E-09
sp|A1K969|ERPA_AZOSB Putative iron-sulfur cluster insertion protein ErpA OS=Azoarcus sp. (strain BH72) GN=erpA PE=3 SV=1 90 166 8.0E-09
sp|Q9X4A0|ERPA_HAEDU Iron-sulfur cluster insertion protein ErpA OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=erpA PE=3 SV=1 86 176 1.0E-08
sp|B0VAE9|ERPA_ACIBY Iron-sulfur cluster insertion protein ErpA OS=Acinetobacter baumannii (strain AYE) GN=erpA PE=3 SV=1 90 167 1.0E-08
sp|A3M0R4|ERPA_ACIBT Iron-sulfur cluster insertion protein ErpA OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=erpA PE=3 SV=2 90 167 1.0E-08
sp|B2I2I7|ERPA_ACIBC Iron-sulfur cluster insertion protein ErpA OS=Acinetobacter baumannii (strain ACICU) GN=erpA PE=3 SV=1 90 167 1.0E-08
sp|B7IAZ8|ERPA_ACIB5 Iron-sulfur cluster insertion protein ErpA OS=Acinetobacter baumannii (strain AB0057) GN=erpA PE=3 SV=1 90 167 1.0E-08
sp|B7GUY5|ERPA_ACIB3 Iron-sulfur cluster insertion protein ErpA OS=Acinetobacter baumannii (strain AB307-0294) GN=erpA PE=3 SV=1 90 167 1.0E-08
sp|Q2SZ67|ERPA_BURTA Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=erpA PE=3 SV=1 90 166 3.0E-08
sp|Q63QW5|ERPA_BURPS Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia pseudomallei (strain K96243) GN=erpA PE=3 SV=1 90 166 3.0E-08
sp|A3NDG6|ERPA_BURP6 Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia pseudomallei (strain 668) GN=erpA PE=3 SV=1 90 166 3.0E-08
sp|Q3JNR3|ERPA_BURP1 Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia pseudomallei (strain 1710b) GN=erpA PE=3 SV=1 90 166 3.0E-08
sp|A3NZ78|ERPA_BURP0 Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia pseudomallei (strain 1106a) GN=erpA PE=3 SV=1 90 166 3.0E-08
sp|A1V053|ERPA_BURMS Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia mallei (strain SAVP1) GN=erpA PE=3 SV=1 90 166 3.0E-08
sp|Q62HB8|ERPA_BURMA Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia mallei (strain ATCC 23344) GN=erpA PE=3 SV=1 90 166 3.0E-08
sp|A2S583|ERPA_BURM9 Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia mallei (strain NCTC 10229) GN=erpA PE=3 SV=1 90 166 3.0E-08
sp|A3MP61|ERPA_BURM7 Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia mallei (strain NCTC 10247) GN=erpA PE=3 SV=1 90 166 3.0E-08
sp|A9AH79|ERPA_BURM1 Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=erpA PE=3 SV=1 90 166 4.0E-08
sp|Q0BI89|ERPA_BURCM Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=erpA PE=3 SV=1 90 166 4.0E-08
sp|B1YTD3|ERPA_BURA4 Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia ambifaria (strain MC40-6) GN=erpA PE=3 SV=1 90 166 4.0E-08
sp|Q39JJ8|ERPA_BURL3 Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=erpA PE=3 SV=1 90 166 4.0E-08
sp|Q9DCB8|ISCA2_MOUSE Iron-sulfur cluster assembly 2 homolog, mitochondrial OS=Mus musculus GN=Isca2 PE=1 SV=2 70 193 4.0E-08
sp|A2SKL7|ERPA_METPP Putative iron-sulfur cluster insertion protein ErpA OS=Methylibium petroleiphilum (strain PM1) GN=erpA PE=3 SV=1 90 166 4.0E-08
sp|B2FJT4|ERPA_STRMK Iron-sulfur cluster insertion protein ErpA OS=Stenotrophomonas maltophilia (strain K279a) GN=erpA PE=3 SV=1 90 166 4.0E-08
sp|B4EET4|ERPA_BURCJ Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=erpA PE=3 SV=1 90 166 5.0E-08
sp|A0K4K7|ERPA_BURCH Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia cenocepacia (strain HI2424) GN=erpA PE=3 SV=1 90 166 5.0E-08
sp|B1JVU6|ERPA_BURCC Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia cenocepacia (strain MC0-3) GN=erpA PE=3 SV=1 90 166 5.0E-08
sp|Q1BZ43|ERPA_BURCA Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia cenocepacia (strain AU 1054) GN=erpA PE=3 SV=1 90 166 5.0E-08
sp|Q53211|Y4VC_RHISN Uncharacterized protein y4vC OS=Rhizobium sp. (strain NGR234) GN=NGR_a01210 PE=3 SV=1 90 177 5.0E-08
sp|A4JBK6|ERPA1_BURVG Putative iron-sulfur cluster insertion protein ErpA 1 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=erpA1 PE=3 SV=1 90 166 6.0E-08
sp|A4T031|ERPA_POLSQ Putative iron-sulfur cluster insertion protein ErpA OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=erpA PE=3 SV=1 88 166 6.0E-08
sp|Q5P7U0|ERPA_AROAE Putative iron-sulfur cluster insertion protein ErpA OS=Aromatoleum aromaticum (strain EbN1) GN=erpA PE=3 SV=1 90 166 7.0E-08
sp|B2UFK5|ERPA_RALPJ Putative iron-sulfur cluster insertion protein ErpA OS=Ralstonia pickettii (strain 12J) GN=erpA PE=3 SV=1 90 166 7.0E-08
sp|Q86U28|ISCA2_HUMAN Iron-sulfur cluster assembly 2 homolog, mitochondrial OS=Homo sapiens GN=ISCA2 PE=1 SV=2 89 166 8.0E-08
sp|Q21MI1|ERPA_SACD2 Iron-sulfur cluster insertion protein ErpA OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=erpA PE=3 SV=1 90 166 8.0E-08
sp|Q5R788|ISCA2_PONAB Iron-sulfur cluster assembly 2 homolog, mitochondrial OS=Pongo abelii GN=ISCA2 PE=2 SV=1 89 166 8.0E-08
sp|Q6FG12|ERPA_ACIAD Iron-sulfur cluster insertion protein ErpA OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=erpA PE=3 SV=1 90 167 1.0E-07
sp|Q2TBG7|ISCA2_BOVIN Iron-sulfur cluster assembly 2 homolog, mitochondrial OS=Bos taurus GN=ISCA2 PE=2 SV=1 89 166 1.0E-07
sp|A4XZB1|ERPA_PSEMY Iron-sulfur cluster insertion protein ErpA OS=Pseudomonas mendocina (strain ymp) GN=erpA PE=3 SV=1 90 166 2.0E-07
sp|A6VN49|ERPA_ACTSZ Iron-sulfur cluster insertion protein ErpA OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=erpA PE=3 SV=1 90 166 2.0E-07
sp|Q1QSB5|ERPA_CHRSD Iron-sulfur cluster insertion protein ErpA OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=erpA PE=3 SV=1 90 166 2.0E-07
sp|B2JGV0|ERPA_BURP8 Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=erpA PE=3 SV=1 90 166 2.0E-07
sp|Q8Y242|ERPA_RALSO Putative iron-sulfur cluster insertion protein ErpA OS=Ralstonia solanacearum (strain GMI1000) GN=erpA PE=3 SV=1 90 166 3.0E-07
sp|A9I246|ERPA_BORPD Putative iron-sulfur cluster insertion protein ErpA OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=erpA PE=3 SV=1 76 166 3.0E-07
sp|Q12425|ISA2_YEAST Iron-sulfur assembly protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISA2 PE=1 SV=1 88 182 3.0E-07
sp|B0TZ08|ERPA_FRAP2 Iron-sulfur cluster insertion protein ErpA OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=erpA PE=3 SV=1 90 166 4.0E-07
sp|Q7VUW2|ERPA_BORPE Putative iron-sulfur cluster insertion protein ErpA OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=erpA PE=3 SV=1 76 166 4.0E-07
sp|Q7W3Z5|ERPA_BORPA Putative iron-sulfur cluster insertion protein ErpA OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=erpA PE=3 SV=1 76 166 4.0E-07
sp|Q7WFC7|ERPA_BORBR Putative iron-sulfur cluster insertion protein ErpA OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=erpA PE=3 SV=1 76 166 4.0E-07
sp|Q0VSN8|ERPA_ALCBS Iron-sulfur cluster insertion protein ErpA OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=erpA PE=3 SV=2 90 167 4.0E-07
sp|Q2KV08|ERPA_BORA1 Putative iron-sulfur cluster insertion protein ErpA OS=Bordetella avium (strain 197N) GN=erpA PE=3 SV=1 76 166 5.0E-07
sp|A3N2B0|ERPA_ACTP2 Iron-sulfur cluster insertion protein ErpA OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=erpA PE=3 SV=1 87 176 6.0E-07
sp|Q2S8Y5|ERPA_HAHCH Iron-sulfur cluster insertion protein ErpA OS=Hahella chejuensis (strain KCTC 2396) GN=erpA PE=3 SV=1 90 166 8.0E-07
sp|A4IZA5|ERPA_FRATW Iron-sulfur cluster insertion protein ErpA OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=erpA PE=3 SV=1 90 166 9.0E-07
sp|Q5NGX6|ERPA_FRATT Iron-sulfur cluster insertion protein ErpA OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=erpA PE=3 SV=1 90 166 9.0E-07
sp|Q0BKU2|ERPA_FRATO Iron-sulfur cluster insertion protein ErpA OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=erpA PE=3 SV=1 90 166 9.0E-07
sp|A0Q5J0|ERPA_FRATN Iron-sulfur cluster insertion protein ErpA OS=Francisella tularensis subsp. novicida (strain U112) GN=erpA PE=3 SV=1 90 166 9.0E-07
sp|B2SDK6|ERPA_FRATM Iron-sulfur cluster insertion protein ErpA OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=erpA PE=3 SV=1 90 166 9.0E-07
sp|Q2A270|ERPA_FRATH Iron-sulfur cluster insertion protein ErpA OS=Francisella tularensis subsp. holarctica (strain LVS) GN=erpA PE=3 SV=1 90 166 9.0E-07
sp|A7NDP2|ERPA_FRATF Iron-sulfur cluster insertion protein ErpA OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=erpA PE=3 SV=1 90 166 9.0E-07
sp|Q14IC8|ERPA_FRAT1 Iron-sulfur cluster insertion protein ErpA OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=erpA PE=3 SV=1 90 166 9.0E-07
sp|Q1GXC7|ERPA_METFK Putative iron-sulfur cluster insertion protein ErpA OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=erpA PE=3 SV=1 90 166 9.0E-07
sp|Q47IC1|ERPA_DECAR Putative iron-sulfur cluster insertion protein ErpA OS=Dechloromonas aromatica (strain RCB) GN=erpA PE=3 SV=1 90 166 9.0E-07
sp|B4SLD1|ERPA_STRM5 Iron-sulfur cluster insertion protein ErpA OS=Stenotrophomonas maltophilia (strain R551-3) GN=erpA PE=3 SV=1 90 166 1.0E-06
sp|Q2NVP9|ERPA_SODGM Iron-sulfur cluster insertion protein ErpA OS=Sodalis glossinidius (strain morsitans) GN=erpA PE=3 SV=1 90 167 1.0E-06
sp|Q9I5Q6|ERPA_PSEAE Iron-sulfur cluster insertion protein ErpA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=erpA PE=3 SV=1 90 166 1.0E-06
sp|Q02TA1|ERPA_PSEAB Iron-sulfur cluster insertion protein ErpA OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=erpA PE=3 SV=1 90 166 1.0E-06
sp|B7V623|ERPA_PSEA8 Iron-sulfur cluster insertion protein ErpA OS=Pseudomonas aeruginosa (strain LESB58) GN=erpA PE=3 SV=1 90 166 1.0E-06
sp|A6UZG6|ERPA_PSEA7 Iron-sulfur cluster insertion protein ErpA OS=Pseudomonas aeruginosa (strain PA7) GN=erpA PE=3 SV=1 90 166 1.0E-06
sp|C1DHX9|ERPA_AZOVD Iron-sulfur cluster insertion protein ErpA OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=erpA PE=3 SV=1 90 166 1.0E-06
sp|P46053|HESB_LEPBY Protein HesB OS=Leptolyngbya boryana GN=hesB PE=3 SV=1 88 167 1.0E-06
sp|Q44540|YNIU_AZOVI Uncharacterized protein in nifU 5'region OS=Azotobacter vinelandii PE=3 SV=1 89 165 1.0E-06
sp|B3H296|ERPA_ACTP7 Iron-sulfur cluster insertion protein ErpA OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=erpA PE=3 SV=1 87 176 1.0E-06
sp|B6EL03|ERPA_ALISL Iron-sulfur cluster insertion protein ErpA OS=Aliivibrio salmonicida (strain LFI1238) GN=erpA PE=3 SV=1 90 167 2.0E-06
sp|P46051|HESB1_ANAVT Protein HesB, heterocyst OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=hesB1 PE=2 SV=1 88 167 2.0E-06
sp|C5BAP7|ERPA_EDWI9 Iron-sulfur cluster insertion protein ErpA OS=Edwardsiella ictaluri (strain 93-146) GN=erpA PE=3 SV=1 90 167 2.0E-06
sp|P18501|HESB_NOSS1 Protein HesB OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hesB PE=3 SV=2 88 167 3.0E-06
sp|B0BR51|ERPA_ACTPJ Iron-sulfur cluster insertion protein ErpA OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=erpA PE=3 SV=1 87 176 3.0E-06
sp|Q3IHQ0|ERPA_PSEHT Iron-sulfur cluster insertion protein ErpA OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=erpA PE=3 SV=1 85 176 3.0E-06
sp|C3LSN2|ERPA_VIBCM Iron-sulfur cluster insertion protein ErpA OS=Vibrio cholerae serotype O1 (strain M66-2) GN=erpA PE=3 SV=1 87 167 4.0E-06
sp|Q9KU96|ERPA_VIBCH Iron-sulfur cluster insertion protein ErpA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=erpA PE=3 SV=1 87 167 4.0E-06
sp|A5F947|ERPA_VIBC3 Iron-sulfur cluster insertion protein ErpA OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=erpA PE=3 SV=1 87 167 4.0E-06
sp|Q60AU6|ERPA2_METCA Iron-sulfur cluster insertion protein ErpA 2 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=erpA2 PE=3 SV=1 90 166 4.0E-06
sp|Q13N17|ERPA2_BURXL Putative iron-sulfur cluster insertion protein ErpA 2 OS=Burkholderia xenovorans (strain LB400) GN=erpA2 PE=3 SV=1 90 166 5.0E-06
sp|B0TIR0|ERPA_SHEHH Iron-sulfur cluster insertion protein ErpA OS=Shewanella halifaxensis (strain HAW-EB4) GN=erpA PE=3 SV=1 86 166 6.0E-06
sp|P46052|HESB2_ANAVT Protein HesB, vegetative OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=hesB2 PE=2 SV=1 88 167 7.0E-06
sp|A7MGR3|ERPA_CROS8 Iron-sulfur cluster insertion protein ErpA OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=erpA PE=3 SV=1 90 166 8.0E-06
sp|Q3Z5K1|ERPA_SHISS Iron-sulfur cluster insertion protein ErpA OS=Shigella sonnei (strain Ss046) GN=erpA PE=3 SV=1 90 167 8.0E-06
sp|P0ACC6|ERPA_SHIFL Iron-sulfur cluster insertion protein ErpA OS=Shigella flexneri GN=erpA PE=3 SV=1 90 167 8.0E-06
sp|Q0T850|ERPA_SHIF8 Iron-sulfur cluster insertion protein ErpA OS=Shigella flexneri serotype 5b (strain 8401) GN=erpA PE=3 SV=1 90 167 8.0E-06
sp|Q32JV2|ERPA_SHIDS Iron-sulfur cluster insertion protein ErpA OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=erpA PE=3 SV=1 90 167 8.0E-06
sp|Q325Y3|ERPA_SHIBS Iron-sulfur cluster insertion protein ErpA OS=Shigella boydii serotype 4 (strain Sb227) GN=erpA PE=3 SV=1 90 167 8.0E-06
sp|B2U301|ERPA_SHIB3 Iron-sulfur cluster insertion protein ErpA OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=erpA PE=3 SV=1 90 167 8.0E-06
sp|B7LWB7|ERPA_ESCF3 Iron-sulfur cluster insertion protein ErpA OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=erpA PE=3 SV=1 90 167 8.0E-06
sp|Q1RG32|ERPA_ECOUT Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli (strain UTI89 / UPEC) GN=erpA PE=3 SV=2 90 167 8.0E-06
sp|B1LGV9|ERPA_ECOSM Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=erpA PE=3 SV=1 90 167 8.0E-06
sp|B6HZD2|ERPA_ECOSE Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli (strain SE11) GN=erpA PE=3 SV=1 90 167 8.0E-06
sp|B7N825|ERPA_ECOLU Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=erpA PE=3 SV=1 90 167 8.0E-06
sp|P0ACC3|ERPA_ECOLI Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli (strain K12) GN=erpA PE=1 SV=1 90 167 8.0E-06
sp|B1IQI4|ERPA_ECOLC Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=erpA PE=3 SV=1 90 167 8.0E-06
sp|P0ACC4|ERPA_ECOL6 Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=erpA PE=3 SV=1 90 167 8.0E-06
sp|Q0TLH5|ERPA_ECOL5 Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=erpA PE=3 SV=1 90 167 8.0E-06
sp|A1A7K2|ERPA_ECOK1 Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli O1:K1 / APEC GN=erpA PE=3 SV=1 90 167 8.0E-06
sp|A7ZWA4|ERPA_ECOHS Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli O9:H4 (strain HS) GN=erpA PE=3 SV=1 90 167 8.0E-06
sp|B1XD26|ERPA_ECODH Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli (strain K12 / DH10B) GN=erpA PE=3 SV=1 90 167 8.0E-06
sp|C4ZRP9|ERPA_ECOBW Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=erpA PE=3 SV=1 90 167 8.0E-06
sp|B7M197|ERPA_ECO8A Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli O8 (strain IAI1) GN=erpA PE=3 SV=1 90 167 8.0E-06
sp|B7MP18|ERPA_ECO81 Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli O81 (strain ED1a) GN=erpA PE=3 SV=1 90 167 8.0E-06
sp|B7NIB9|ERPA_ECO7I Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=erpA PE=3 SV=1 90 167 8.0E-06
sp|B5Z0D6|ERPA_ECO5E Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=erpA PE=3 SV=1 90 167 8.0E-06
sp|P0ACC5|ERPA_ECO57 Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli O157:H7 GN=erpA PE=3 SV=1 90 167 8.0E-06
sp|B7LGL8|ERPA_ECO55 Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli (strain 55989 / EAEC) GN=erpA PE=3 SV=1 90 167 8.0E-06
sp|B7MBD9|ERPA_ECO45 Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=erpA PE=3 SV=1 90 167 8.0E-06
sp|B7UIK3|ERPA_ECO27 Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=erpA PE=3 SV=1 90 167 8.0E-06
sp|A7ZHP8|ERPA_ECO24 Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=erpA PE=3 SV=1 90 167 8.0E-06
sp|Q7CR66|ERPA_SALTY Iron-sulfur cluster insertion protein ErpA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=erpA PE=3 SV=2 90 167 8.0E-06
sp|Q8XFF3|ERPA_SALTI Iron-sulfur cluster insertion protein ErpA OS=Salmonella typhi GN=erpA PE=3 SV=2 90 167 8.0E-06
sp|B4TXQ8|ERPA_SALSV Iron-sulfur cluster insertion protein ErpA OS=Salmonella schwarzengrund (strain CVM19633) GN=erpA PE=3 SV=1 90 167 8.0E-06
sp|A9N0Q2|ERPA_SALPB Iron-sulfur cluster insertion protein ErpA OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=erpA PE=3 SV=1 90 167 8.0E-06
sp|Q5PD49|ERPA_SALPA Iron-sulfur cluster insertion protein ErpA OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=erpA PE=3 SV=2 90 167 8.0E-06
sp|B4SUY6|ERPA_SALNS Iron-sulfur cluster insertion protein ErpA OS=Salmonella newport (strain SL254) GN=erpA PE=3 SV=1 90 167 8.0E-06
sp|B4TK32|ERPA_SALHS Iron-sulfur cluster insertion protein ErpA OS=Salmonella heidelberg (strain SL476) GN=erpA PE=3 SV=1 90 167 8.0E-06
sp|B5RHE2|ERPA_SALG2 Iron-sulfur cluster insertion protein ErpA OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=erpA PE=3 SV=1 90 167 8.0E-06
sp|B5R3G8|ERPA_SALEP Iron-sulfur cluster insertion protein ErpA OS=Salmonella enteritidis PT4 (strain P125109) GN=erpA PE=3 SV=1 90 167 8.0E-06
sp|B5FJ03|ERPA_SALDC Iron-sulfur cluster insertion protein ErpA OS=Salmonella dublin (strain CT_02021853) GN=erpA PE=3 SV=1 90 167 8.0E-06
sp|Q57T51|ERPA_SALCH Iron-sulfur cluster insertion protein ErpA OS=Salmonella choleraesuis (strain SC-B67) GN=erpA PE=3 SV=2 90 167 8.0E-06
sp|A9MPK5|ERPA_SALAR Iron-sulfur cluster insertion protein ErpA OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=erpA PE=3 SV=1 90 167 8.0E-06
sp|B5F8R7|ERPA_SALA4 Iron-sulfur cluster insertion protein ErpA OS=Salmonella agona (strain SL483) GN=erpA PE=3 SV=1 90 167 8.0E-06
sp|A5UFF5|ERPA_HAEIG Iron-sulfur cluster insertion protein ErpA OS=Haemophilus influenzae (strain PittGG) GN=erpA PE=3 SV=1 90 166 8.0E-06
sp|Q4QJM4|ERPA_HAEI8 Iron-sulfur cluster insertion protein ErpA OS=Haemophilus influenzae (strain 86-028NP) GN=erpA PE=3 SV=1 90 166 8.0E-06
sp|B5FAL7|ERPA_VIBFM Iron-sulfur cluster insertion protein ErpA OS=Vibrio fischeri (strain MJ11) GN=erpA PE=3 SV=1 90 166 9.0E-06
sp|Q5E2W7|ERPA_VIBF1 Iron-sulfur cluster insertion protein ErpA OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=erpA PE=3 SV=1 90 166 9.0E-06
sp|Q65SZ6|ERPA_MANSM Iron-sulfur cluster insertion protein ErpA OS=Mannheimia succiniciproducens (strain MBEL55E) GN=erpA PE=3 SV=1 88 166 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|579800
MLRHTPRLTRAASPLIPRRISARISSPRLLTRSFPPISIARKLSTTTARYAALAGDTPGQSIVVLQTPSPEYLEQ
EEVDVELLPSDQIQLTITDRAAEQLRSIATRSGDPSAALRISVESGGCHGYQYNIQLAKEILPDDYRFSHPAVRP
SNVVVDAVSLPLLNGSVRLAVAVDSAGSSSELGRAMKEVAHRPLLPGETIEAESSQSHMKTNIDRANRLS*
Coding >Agabi119p4|579800
ATGCTTCGTCATACTCCTCGTCTCACCCGAGCTGCATCCCCTCTCATTCCGAGGCGCATATCAGCTCGTATATCG
TCCCCTCGTCTCCTGACCCGTTCCTTTCCTCCCATTTCCATTGCGCGGAAGCTTTCAACAACTACAGCACGATAT
GCTGCACTGGCGGGGGATACACCGGGGCAGTCAATAGTTGTACTCCAGACACCGTCTCCGGAATATCTAGAACAA
GAAGAAGTTGATGTTGAACTATTGCCGTCCGACCAGATCCAATTAACTATCACTGATAGGGCTGCCGAGCAACTC
AGATCGATAGCAACAAGAAGTGGTGATCCTTCTGCAGCTCTGCGGATATCTGTCGAGTCAGGGGGATGTCACGGT
TACCAGTATAATATTCAGTTGGCCAAGGAGATTCTACCCGATGACTACCGTTTTTCCCACCCTGCAGTAAGGCCC
TCAAACGTCGTAGTCGATGCCGTCTCACTACCGCTTCTCAACGGCTCCGTGCGGCTGGCTGTGGCTGTGGACTCA
GCTGGGAGCTCAAGTGAACTGGGAAGGGCAATGAAAGAGGTGGCACATCGGCCGTTATTACCAGGAGAAACCATT
GAGGCTGAATCATCTCAAAGCCACATGAAGACGAACATCGACAGAGCTAATAGGCTCTCATAA
Transcript >Agabi119p4|579800
ATGCTTCGTCATACTCCTCGTCTCACCCGAGCTGCATCCCCTCTCATTCCGAGGCGCATATCAGCTCGTATATCG
TCCCCTCGTCTCCTGACCCGTTCCTTTCCTCCCATTTCCATTGCGCGGAAGCTTTCAACAACTACAGCACGATAT
GCTGCACTGGCGGGGGATACACCGGGGCAGTCAATAGTTGTACTCCAGACACCGTCTCCGGAATATCTAGAACAA
GAAGAAGTTGATGTTGAACTATTGCCGTCCGACCAGATCCAATTAACTATCACTGATAGGGCTGCCGAGCAACTC
AGATCGATAGCAACAAGAAGTGGTGATCCTTCTGCAGCTCTGCGGATATCTGTCGAGTCAGGGGGATGTCACGGT
TACCAGTATAATATTCAGTTGGCCAAGGAGATTCTACCCGATGACTACCGTTTTTCCCACCCTGCAGTAAGGCCC
TCAAACGTCGTAGTCGATGCCGTCTCACTACCGCTTCTCAACGGCTCCGTGCGGCTGGCTGTGGCTGTGGACTCA
GCTGGGAGCTCAAGTGAACTGGGAAGGGCAATGAAAGAGGTGGCACATCGGCCGTTATTACCAGGAGAAACCATT
GAGGCTGAATCATCTCAAAGCCACATGAAGACGAACATCGACAGAGCTAATAGGCTCTCATAA
Gene >Agabi119p4|579800
ATGCTTCGTCATACTCCTCGTCTCACCCGAGCTGCATCCCCTCTCATTCCGAGGCGCATATCAGCTCGTATATCG
TCCCCTCGTCTCCTGACCCGTTCCTTTCCTCCCATTTCCATTGCGCGGAAGCTTTCAACAACTACAGCACGATAT
GCTGCACTGGCGGGGGATACACCGGGGCAGTCAATAGTTGTACTCCAGACACCGTCTCCGGAATATCTAGAACAA
GAAGAAGTTGATGTTGAACTATTGCCGTCCGACCAGATCCAATTAACTATCACTGATAGGGCTGCCGAGGTTGGC
ATTCATCTTTTATGTTACGAAAAACGAGCCAGTATTGATTATAGAAAACAGCAACTCAGATCGATAGCAACAAGA
AGTGGTGATCCTTCTGCAGCTCTGCGGATATCTGTCGAGTCAGGGGGATGTCACGGTTACCAGTATAATATTCAG
TTGGCCAAGGAGATTCTACCCGATGACTAGTAAGCTCACTTTGATGTTTTATCGTACGTCCTACTGACATGTATA
TAATTCAAGCCGTTTTTCCCACCCTGCAGTAAGGCCCTCAAACGTCGTAGTCGATGCCGTCTCACTACCGCTTCT
CAACGGCTCCGTGGTGGATTATGTGACAGAATTGATTGGTAGCAGCTTCCGCGTCATGAACAATCCCCATGCCAA
AGCGGCTGGCTGTGGCTGTGGACTCAGCTGGGAGCTCAAGTGAACTGGGAAGGGCAATGAAAGAGGTGGCACATC
GGCCGTTGTATGTTTAAATTATGTTTTTGCGCATTAGACTGATCAACTATCTTATCACCATTCTGTCCTTTGTAT
ACCTACTTCAATTGCGTTTAAAACAGATTACCAGGAGAAACCATTGAGGCTGAATCATCTCAAAGCCACATGAAG
ACGAACATCGACAGAGCTAATAGGCTCTCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail