Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|579550
Gene name
Locationscaffold_02:1105874..1107183
Strand+
Gene length (bp)1309
Transcript length (bp)999
Coding sequence length (bp)999
Protein length (aa) 333

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 1.0E-37 58 247
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 8.2E-21 63 246
PF08659 KR KR domain 8.5E-05 58 222

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B0D8R3|MKAR_LACBS Very-long-chain 3-oxoacyl-CoA reductase OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=LACBIDRAFT_192627 PE=3 SV=1 2 332 2.0E-167
sp|A8N6B4|MKAR_COPC7 Very-long-chain 3-oxoacyl-CoA reductase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CC1G_02019 PE=3 SV=1 18 332 2.0E-166
sp|A1DH66|MKAR_NEOFI Very-long-chain 3-oxoacyl-CoA reductase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_086780 PE=3 SV=1 17 329 2.0E-99
sp|A2QCH3|MKAR_ASPNC Very-long-chain 3-oxoacyl-CoA reductase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An02g03570 PE=3 SV=1 2 329 5.0E-98
sp|Q4X117|MKAR_ASPFU Very-long-chain 3-oxoacyl-CoA reductase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G11540 PE=3 SV=1 17 329 6.0E-98
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B0D8R3|MKAR_LACBS Very-long-chain 3-oxoacyl-CoA reductase OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=LACBIDRAFT_192627 PE=3 SV=1 2 332 2.0E-167
sp|A8N6B4|MKAR_COPC7 Very-long-chain 3-oxoacyl-CoA reductase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CC1G_02019 PE=3 SV=1 18 332 2.0E-166
sp|A1DH66|MKAR_NEOFI Very-long-chain 3-oxoacyl-CoA reductase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_086780 PE=3 SV=1 17 329 2.0E-99
sp|A2QCH3|MKAR_ASPNC Very-long-chain 3-oxoacyl-CoA reductase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An02g03570 PE=3 SV=1 2 329 5.0E-98
sp|Q4X117|MKAR_ASPFU Very-long-chain 3-oxoacyl-CoA reductase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G11540 PE=3 SV=1 17 329 6.0E-98
sp|B0XSI3|MKAR_ASPFC Very-long-chain 3-oxoacyl-CoA reductase OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_027290 PE=3 SV=1 17 329 6.0E-98
sp|Q0CY11|MKAR_ASPTN Very-long-chain 3-oxoacyl-CoA reductase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ATEG_01423 PE=3 SV=1 36 329 6.0E-97
sp|Q5B0R9|MKAR_EMENI Very-long-chain 3-oxoacyl-CoA reductase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN5861 PE=3 SV=1 3 328 2.0E-96
sp|A6RBW9|MKAR_AJECN Very-long-chain 3-oxoacyl-CoA reductase OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=HCAG_07127 PE=3 SV=1 8 329 3.0E-96
sp|A6SG70|MKAR_BOTFB Very-long-chain 3-oxoacyl-CoA reductase OS=Botryotinia fuckeliana (strain B05.10) GN=BC1G_11561 PE=3 SV=1 18 330 1.0E-95
sp|A7F8T1|MKAR_SCLS1 Very-long-chain 3-oxoacyl-CoA reductase OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_14012 PE=3 SV=1 14 330 2.0E-94
sp|Q4P622|MKAR_USTMA Very-long-chain 3-oxoacyl-CoA reductase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_04441 PE=3 SV=1 15 330 6.0E-93
sp|Q7RYE5|MKAR_NEUCR Very-long-chain 3-oxoacyl-CoA reductase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU11297 PE=3 SV=1 12 332 4.0E-92
sp|A4QTE3|MKAR_MAGO7 Very-long-chain 3-oxoacyl-CoA reductase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_05096 PE=3 SV=1 14 330 6.0E-92
sp|Q2UET3|MKAR_ASPOR Very-long-chain 3-oxoacyl-CoA reductase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090026000492 PE=3 SV=1 2 329 2.0E-91
sp|B2B3L4|MKAR_PODAN Very-long-chain 3-oxoacyl-CoA reductase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PODANS_6_6580 PE=3 SV=2 20 332 3.0E-91
sp|Q2H1V7|MKAR_CHAGB Very-long-chain 3-oxoacyl-CoA reductase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_04239 PE=3 SV=1 18 332 5.0E-91
sp|A1C6J8|MKAR_ASPCL Very-long-chain 3-oxoacyl-CoA reductase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_070510 PE=3 SV=1 17 329 3.0E-90
sp|Q1DNC5|MKAR_COCIM Very-long-chain 3-oxoacyl-CoA reductase OS=Coccidioides immitis (strain RS) GN=CIMG_08188 PE=3 SV=2 17 332 4.0E-88
sp|B2WMJ3|MKAR_PYRTR Very-long-chain 3-oxoacyl-CoA reductase OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=PTRG_11203 PE=3 SV=2 18 332 2.0E-87
sp|Q0U3N7|MKAR_PHANO Very-long-chain 3-oxoacyl-CoA reductase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_13627 PE=3 SV=1 30 332 2.0E-87
sp|P0CR34|MKAR_CRYNJ Very-long-chain 3-oxoacyl-CoA reductase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNI00690 PE=3 SV=1 14 330 1.0E-84
sp|P0CR35|MKAR_CRYNB Very-long-chain 3-oxoacyl-CoA reductase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CNBH0660 PE=3 SV=1 14 330 1.0E-84
sp|A8Q1U2|MKAR_MALGO Very-long-chain 3-oxoacyl-CoA reductase OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=MGL_1839 PE=3 SV=1 17 332 8.0E-84
sp|A7TMJ2|MKAR_VANPO Very-long-chain 3-oxoacyl-CoA reductase OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_513p6 PE=3 SV=1 18 332 1.0E-82
sp|Q6CVS4|MKAR_KLULA Very-long-chain 3-oxoacyl-CoA reductase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KLLA0B09812g PE=3 SV=1 24 332 4.0E-82
sp|Q6CHP1|MKAR_YARLI Very-long-chain 3-oxoacyl-CoA reductase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0A06787g PE=3 SV=1 4 331 7.0E-77
sp|Q6BIG0|MKAR_DEBHA Very-long-chain 3-oxoacyl-CoA reductase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DEHA2G10780g PE=3 SV=1 35 327 5.0E-76
sp|Q10245|MKAR_SCHPO Very-long-chain 3-oxoacyl-CoA reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G9.15 PE=3 SV=1 23 327 3.0E-75
sp|A5DND6|MKAR_PICGU Very-long-chain 3-oxoacyl-CoA reductase OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PGUG_04787 PE=3 SV=1 41 330 7.0E-75
sp|Q75A60|MKAR_ASHGO Very-long-chain 3-oxoacyl-CoA reductase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ADR059C PE=3 SV=2 21 317 2.0E-74
sp|A6ZLA1|MKAR_YEAS7 Very-long-chain 3-oxoacyl-CoA reductase OS=Saccharomyces cerevisiae (strain YJM789) GN=SCY_0371 PE=3 SV=1 17 332 7.0E-74
sp|B3LN00|MKAR_YEAS1 Very-long-chain 3-oxoacyl-CoA reductase OS=Saccharomyces cerevisiae (strain RM11-1a) GN=SCRG_02811 PE=3 SV=1 17 332 7.0E-74
sp|A5E0R1|MKAR_LODEL Very-long-chain 3-oxoacyl-CoA reductase OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=LELG_03198 PE=3 SV=1 13 330 6.0E-73
sp|A3LXZ3|MKAR_PICST Very-long-chain 3-oxoacyl-CoA reductase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PICST_79198 PE=3 SV=1 12 295 1.0E-72
sp|P38286|MKAR_YEAST Very-long-chain 3-oxoacyl-CoA reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IFA38 PE=1 SV=1 17 332 9.0E-72
sp|Q6FRM0|MKAR_CANGA Very-long-chain 3-oxoacyl-CoA reductase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CAGL0H07513g PE=3 SV=1 18 330 2.0E-71
sp|Q59V93|MKAR_CANAL Very-long-chain 3-oxoacyl-CoA reductase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CaO19.11340 PE=3 SV=2 12 319 3.0E-69
sp|Q8L9C4|KCR1_ARATH Very-long-chain 3-oxoacyl-CoA reductase 1 OS=Arabidopsis thaliana GN=KCR1 PE=1 SV=1 16 330 4.0E-59
sp|Q28IU1|DHB12_XENTR Very-long-chain 3-oxoacyl-CoA reductase OS=Xenopus tropicalis GN=hsd17b12 PE=2 SV=1 47 328 6.0E-58
sp|O57314|DHB12_ANAPL Very-long-chain 3-oxoacyl-CoA reductase OS=Anas platyrhynchos GN=HSD17B12 PE=2 SV=1 45 329 7.0E-58
sp|Q8AVY8|DH12B_XENLA Very-long-chain 3-oxoacyl-CoA reductase-B OS=Xenopus laevis GN=hsd17b12-b PE=2 SV=1 47 327 4.0E-56
sp|Q5XG41|DH12A_XENLA Very-long-chain 3-oxoacyl-CoA reductase-A OS=Xenopus laevis GN=hsd17b12-a PE=2 SV=1 47 328 2.0E-55
sp|Q4R5G7|DHB12_MACFA Very-long-chain 3-oxoacyl-CoA reductase OS=Macaca fascicularis GN=HSD17B12 PE=2 SV=1 52 328 3.0E-55
sp|Q53GQ0|DHB12_HUMAN Very-long-chain 3-oxoacyl-CoA reductase OS=Homo sapiens GN=HSD17B12 PE=1 SV=2 52 328 7.0E-55
sp|Q6P7R8|DHB12_RAT Very-long-chain 3-oxoacyl-CoA reductase OS=Rattus norvegicus GN=Hsd17b12 PE=2 SV=1 52 328 1.0E-53
sp|Q6P3L6|DH12A_DANRE Very-long-chain 3-oxoacyl-CoA reductase-A OS=Danio rerio GN=hsd17b12a PE=2 SV=1 54 323 1.0E-52
sp|Q5E9H7|DHB12_BOVIN Very-long-chain 3-oxoacyl-CoA reductase OS=Bos taurus GN=HSD17B12 PE=2 SV=1 56 271 1.0E-52
sp|O70503|DHB12_MOUSE Very-long-chain 3-oxoacyl-CoA reductase OS=Mus musculus GN=Hsd17b12 PE=1 SV=1 52 328 3.0E-52
sp|Q6QA33|DH12B_DANRE Very-long-chain 3-oxoacyl-CoA reductase-B OS=Danio rerio GN=hsd17b12b PE=2 SV=2 18 327 5.0E-49
sp|Q4V8B7|HSDL1_RAT Inactive hydroxysteroid dehydrogenase-like protein 1 OS=Rattus norvegicus GN=Hsdl1 PE=2 SV=1 56 322 1.0E-45
sp|Q09517|LE767_CAEEL Very-long-chain 3-oxooacyl-coA reductase let-767 OS=Caenorhabditis elegans GN=let-767 PE=1 SV=2 18 332 2.0E-45
sp|Q3SXM5|HSDL1_HUMAN Inactive hydroxysteroid dehydrogenase-like protein 1 OS=Homo sapiens GN=HSDL1 PE=1 SV=3 56 322 3.0E-45
sp|Q60V51|LE767_CAEBR Very-long-chain 3-oxooacyl-coA reductase let-767 OS=Caenorhabditis briggsae GN=let-767 PE=3 SV=1 18 332 5.0E-45
sp|Q5R7K0|HSDL1_PONAB Inactive hydroxysteroid dehydrogenase-like protein 1 OS=Pongo abelii GN=HSDL1 PE=2 SV=1 56 322 6.0E-45
sp|A5PJF6|HSDL1_BOVIN Inactive hydroxysteroid dehydrogenase-like protein 1 OS=Bos taurus GN=HSDL1 PE=2 SV=1 56 322 1.0E-44
sp|Q8BTX9|HSDL1_MOUSE Inactive hydroxysteroid dehydrogenase-like protein 1 OS=Mus musculus GN=Hsdl1 PE=1 SV=1 56 322 3.0E-44
sp|Q9FYL6|KCR2_ARATH Very-long-chain 3-oxoacyl-CoA reductase-like protein At1g24470 OS=Arabidopsis thaliana GN=KCR2 PE=2 SV=1 21 322 2.0E-41
sp|Q5ZJG8|HSDL1_CHICK Hydroxysteroid dehydrogenase-like protein 1 OS=Gallus gallus GN=HSDL1 PE=2 SV=1 54 292 2.0E-40
sp|Q17704|STDH3_CAEEL Putative steroid dehydrogenase 3 OS=Caenorhabditis elegans GN=stdh-3 PE=3 SV=2 19 329 1.0E-38
sp|P37058|DHB3_HUMAN Testosterone 17-beta-dehydrogenase 3 OS=Homo sapiens GN=HSD17B3 PE=1 SV=2 56 275 2.0E-38
sp|O54939|DHB3_RAT Testosterone 17-beta-dehydrogenase 3 OS=Rattus norvegicus GN=Hsd17b3 PE=2 SV=1 18 275 6.0E-38
sp|O17795|STDH2_CAEEL Putative steroid dehydrogenase 2 OS=Caenorhabditis elegans GN=stdh-2 PE=3 SV=1 20 328 9.0E-38
sp|O16925|STDH4_CAEEL Putative steroid dehydrogenase 4 OS=Caenorhabditis elegans GN=stdh-4 PE=3 SV=2 60 292 2.0E-35
sp|P70385|DHB3_MOUSE Testosterone 17-beta-dehydrogenase 3 OS=Mus musculus GN=Hsd17b3 PE=1 SV=2 49 247 2.0E-35
sp|Q17703|STDH1_CAEEL Putative steroid dehydrogenase 1 OS=Caenorhabditis elegans GN=stdh-1 PE=3 SV=1 20 328 4.0E-35
sp|Q10130|DHS5_CAEEL Uncharacterized oxidoreductase dhs-5 OS=Caenorhabditis elegans GN=dhs-5 PE=3 SV=2 58 271 1.0E-22
sp|Q11177|DHS27_CAEEL Uncharacterized oxidoreductase dhs-27 OS=Caenorhabditis elegans GN=dhs-27 PE=3 SV=2 11 198 4.0E-22
sp|A5WWC6|HSDL1_DANRE Inactive hydroxysteroid dehydrogenase-like protein 1 OS=Danio rerio GN=hsdl1 PE=2 SV=1 27 292 5.0E-22
sp|Q5RJY4|DRS7B_RAT Dehydrogenase/reductase SDR family member 7B OS=Rattus norvegicus GN=Dhrs7b PE=1 SV=1 16 246 4.0E-20
sp|Q9P7B4|YI13_SCHPO NADP-dependent 3-hydroxy acid dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC521.03 PE=1 SV=1 56 249 2.0E-18
sp|Q99J47|DRS7B_MOUSE Dehydrogenase/reductase SDR family member 7B OS=Mus musculus GN=Dhrs7b PE=1 SV=1 55 246 2.0E-18
sp|P55434|Y4EK_RHISN Uncharacterized short-chain type dehydrogenase/reductase y4eK OS=Rhizobium sp. (strain NGR234) GN=NGR_a03840 PE=3 SV=1 59 222 2.0E-18
sp|P54554|YQJQ_BACSU Uncharacterized oxidoreductase YqjQ OS=Bacillus subtilis (strain 168) GN=yqjQ PE=3 SV=1 53 237 4.0E-18
sp|P14802|YOXD_BACSU Uncharacterized oxidoreductase YoxD OS=Bacillus subtilis (strain 168) GN=yoxD PE=3 SV=2 73 246 4.0E-18
sp|Q9CXR1|DHRS7_MOUSE Dehydrogenase/reductase SDR family member 7 OS=Mus musculus GN=Dhrs7 PE=1 SV=2 61 226 2.0E-17
sp|Q5HLD8|Y2049_STAEQ Uncharacterized oxidoreductase SERP2049 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP2049 PE=3 SV=1 55 247 3.0E-17
sp|Q8CN40|Y2036_STAES Uncharacterized oxidoreductase SE_2036 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_2036 PE=3 SV=1 55 247 3.0E-17
sp|P25970|Y5909_MYXXD Uncharacterized oxidoreductase MXAN_5909 OS=Myxococcus xanthus (strain DK 1622) GN=MXAN_5909 PE=3 SV=2 59 258 4.0E-17
sp|Q3T0R4|DRS7B_BOVIN Dehydrogenase/reductase SDR family member 7B OS=Bos taurus GN=DHRS7B PE=2 SV=1 55 246 9.0E-17
sp|Q9Y394|DHRS7_HUMAN Dehydrogenase/reductase SDR family member 7 OS=Homo sapiens GN=DHRS7 PE=1 SV=1 61 226 1.0E-16
sp|Q5R6U1|DRS7B_PONAB Dehydrogenase/reductase SDR family member 7B OS=Pongo abelii GN=DHRS7B PE=2 SV=2 55 246 7.0E-16
sp|Q6NUE2|CBR4_XENLA Carbonyl reductase family member 4 OS=Xenopus laevis GN=cbr4 PE=2 SV=1 61 259 7.0E-16
sp|Q6IAN0|DRS7B_HUMAN Dehydrogenase/reductase SDR family member 7B OS=Homo sapiens GN=DHRS7B PE=1 SV=2 55 246 1.0E-15
sp|P0A0I0|FABG_STAAW 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MW2) GN=fabG PE=3 SV=1 59 246 2.0E-15
sp|Q6G9Y2|FABG_STAAS 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MSSA476) GN=fabG PE=3 SV=1 59 246 2.0E-15
sp|Q6GHK4|FABG_STAAR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MRSA252) GN=fabG PE=3 SV=1 59 246 2.0E-15
sp|P99093|FABG_STAAN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain N315) GN=fabG PE=1 SV=1 59 246 2.0E-15
sp|P0A0H9|FABG_STAAM 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabG PE=1 SV=1 59 246 2.0E-15
sp|Q5HGK2|FABG_STAAC 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain COL) GN=fabG PE=3 SV=2 59 246 2.0E-15
sp|O67610|FABG_AQUAE 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Aquifex aeolicus (strain VF5) GN=fabG PE=1 SV=1 55 259 3.0E-15
sp|P69936|YDFG_SALTY NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ydfG PE=3 SV=1 60 219 3.0E-15
sp|P69935|YDFG_SALTI NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Salmonella typhi GN=ydfG PE=3 SV=1 60 219 3.0E-15
sp|O32229|YVAG_BACSU Uncharacterized oxidoreductase YvaG OS=Bacillus subtilis (strain 168) GN=yvaG PE=3 SV=1 55 236 3.0E-15
sp|Q8CPI3|FABG_STAES 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus epidermidis (strain ATCC 12228) GN=fabG PE=3 SV=1 59 246 8.0E-15
sp|Q5HPW0|FABG_STAEQ 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=fabG PE=3 SV=1 59 246 8.0E-15
sp|Q9KQH7|FABG_VIBCH 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fabG PE=1 SV=2 55 247 1.0E-14
sp|Q8FHD2|YDFG_ECOL6 NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ydfG PE=3 SV=2 60 219 2.0E-14
sp|Q8X505|YDFG_ECO57 NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Escherichia coli O157:H7 GN=ydfG PE=3 SV=1 60 219 2.0E-14
sp|Q83RE8|YDFG_SHIFL NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Shigella flexneri GN=ydfG PE=3 SV=2 60 249 2.0E-14
sp|O54438|FABG_PSEAE 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=fabG PE=1 SV=1 55 269 2.0E-14
sp|P39831|YDFG_ECOLI NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Escherichia coli (strain K12) GN=ydfG PE=1 SV=2 60 219 3.0E-14
sp|P50199|GNO_GLUOX Gluconate 5-dehydrogenase OS=Gluconobacter oxydans (strain 621H) GN=gno PE=1 SV=1 56 247 4.0E-14
sp|Q9PKF7|FABG_CHLMU 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia muridarum (strain MoPn / Nigg) GN=fabG PE=3 SV=1 59 247 4.0E-14
sp|Q0IH28|DRS7B_XENLA Dehydrogenase/reductase SDR family member 7B OS=Xenopus laevis GN=dhrs7b PE=2 SV=1 55 246 5.0E-14
sp|O34782|YVRD_BACSU Uncharacterized oxidoreductase YvrD OS=Bacillus subtilis (strain 168) GN=yvrD PE=3 SV=1 60 236 5.0E-14
sp|Q7Q732|DHRS7_ANOGA Dehydrogenase/reductase SDR family protein 7-like OS=Anopheles gambiae GN=AGAP005532 PE=3 SV=3 55 246 6.0E-14
sp|P94681|TSAC_COMTE 4-formylbenzenesulfonate dehydrogenase TsaC1/TsaC2 OS=Comamonas testosteroni GN=tsaC1 PE=1 SV=1 59 237 7.0E-14
sp|P45200|Y1430_HAEIN Probable NADP-dependent dehydrogenase HI_1430 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1430 PE=3 SV=1 59 236 1.0E-13
sp|P51831|FABG_BACSU 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Bacillus subtilis (strain 168) GN=fabG PE=3 SV=3 59 260 2.0E-13
sp|D3U1D9|ISFD_KLEOX Sulfoacetaldehyde reductase OS=Klebsiella oxytoca GN=isfD PE=1 SV=1 61 222 2.0E-13
sp|Q05016|YM71_YEAST NADP-dependent 3-hydroxy acid dehydrogenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR226C PE=1 SV=1 44 249 2.0E-13
sp|P38004|FABG_CHLTR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=fabG PE=3 SV=3 59 271 3.0E-13
sp|P16544|ACT3_STRCO Putative ketoacyl reductase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=actIII PE=1 SV=1 59 246 5.0E-13
sp|Q8K9J5|FABG_BUCAP 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=fabG PE=3 SV=1 59 259 9.0E-13
sp|Q4A054|Y0419_STAS1 Uncharacterized oxidoreductase SSP0419 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP0419 PE=3 SV=1 59 246 1.0E-12
sp|Q99RF5|Y2478_STAAM Uncharacterized oxidoreductase SAV2478 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2478 PE=3 SV=1 59 241 1.0E-12
sp|Q7A3L9|Y2266_STAAN Uncharacterized oxidoreductase SA2266 OS=Staphylococcus aureus (strain N315) GN=SA2266 PE=1 SV=1 59 241 1.0E-12
sp|Q49WS9|Y1627_STAS1 Uncharacterized oxidoreductase SSP1627 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP1627 PE=3 SV=1 55 225 2.0E-12
sp|Q6GDV6|Y2567_STAAR Uncharacterized oxidoreductase SAR2567 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2567 PE=3 SV=1 59 241 2.0E-12
sp|Q2FVD5|Y2778_STAA8 Uncharacterized oxidoreductase SAOUHSC_02778 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02778 PE=3 SV=1 59 241 2.0E-12
sp|Q5HD73|Y2488_STAAC Uncharacterized oxidoreductase SACOL2488 OS=Staphylococcus aureus (strain COL) GN=SACOL2488 PE=3 SV=1 59 241 2.0E-12
sp|Q2FE21|Y2422_STAA3 Uncharacterized oxidoreductase SAUSA300_2422 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_2422 PE=3 SV=1 59 241 2.0E-12
sp|Q8NUV9|Y2403_STAAW Uncharacterized oxidoreductase MW2403 OS=Staphylococcus aureus (strain MW2) GN=MW2403 PE=3 SV=1 59 241 3.0E-12
sp|Q6G6J1|Y2370_STAAS Uncharacterized oxidoreductase SAS2370 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2370 PE=3 SV=1 59 241 3.0E-12
sp|P43713|FABG_HAEIN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fabG PE=3 SV=1 55 258 4.0E-12
sp|Q0VFE7|DRS7B_XENTR Dehydrogenase/reductase SDR family member 7B OS=Xenopus tropicalis GN=dhrs7b PE=2 SV=1 55 246 4.0E-12
sp|Q8SPU8|DHRS4_BOVIN Dehydrogenase/reductase SDR family member 4 OS=Bos taurus GN=DHRS4 PE=2 SV=2 59 248 5.0E-12
sp|P50941|FABG_RICPR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Rickettsia prowazekii (strain Madrid E) GN=fabG PE=1 SV=2 56 246 6.0E-12
sp|Q8CQD2|BUTA_STAES Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus epidermidis (strain ATCC 12228) GN=butA PE=3 SV=1 59 233 7.0E-12
sp|Q9Y140|DHRS7_DROME Dehydrogenase/reductase SDR family protein 7-like OS=Drosophila melanogaster GN=CG7601 PE=2 SV=1 50 246 8.0E-12
sp|Q5HKG6|BUTA_STAEQ Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=butA PE=3 SV=1 59 233 1.0E-11
sp|Q9KWN1|SDH_RHIRD Serine 3-dehydrogenase OS=Rhizobium radiobacter GN=sdh PE=1 SV=1 60 249 1.0E-11
sp|Q9X6U2|BDHA_CUPNH D-beta-hydroxybutyrate dehydrogenase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=hbdH1 PE=3 SV=2 55 268 2.0E-11
sp|P41177|DHKR_STRCM Monensin polyketide synthase putative ketoacyl reductase OS=Streptomyces cinnamonensis PE=3 SV=1 59 253 2.0E-11
sp|O31767|YMFI_BACSU Uncharacterized oxidoreductase YmfI OS=Bacillus subtilis (strain 168) GN=ymfI PE=3 SV=2 59 236 2.0E-11
sp|Q9X248|FABG_THEMA 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=fabG PE=3 SV=1 55 258 2.0E-11
sp|P16542|DHK1_STRVN Granaticin polyketide synthase putative ketoacyl reductase 1 OS=Streptomyces violaceoruber GN=gra-orf5 PE=3 SV=1 59 247 2.0E-11
sp|P50164|TRN2_HYONI Tropinone reductase 2 OS=Hyoscyamus niger GN=TR2 PE=2 SV=1 55 236 3.0E-11
sp|P51658|DHB2_MOUSE Estradiol 17-beta-dehydrogenase 2 OS=Mus musculus GN=Hsd17b2 PE=1 SV=2 60 228 3.0E-11
sp|Q8U8I2|SDH_AGRFC Serine 3-dehydrogenase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=sdh PE=3 SV=1 60 249 4.0E-11
sp|P06234|NODG_RHIME Nodulation protein G OS=Rhizobium meliloti (strain 1021) GN=nodG PE=3 SV=1 56 258 4.0E-11
sp|P50233|DHI2_RAT Corticosteroid 11-beta-dehydrogenase isozyme 2 OS=Rattus norvegicus GN=Hsd11b2 PE=1 SV=1 60 226 4.0E-11
sp|Q6F7B8|ACR1_ACIAD Fatty acyl-CoA reductase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=acr1 PE=1 SV=2 55 236 5.0E-11
sp|P51976|DHI2_RABIT Corticosteroid 11-beta-dehydrogenase isozyme 2 OS=Oryctolagus cuniculus GN=HSD11B2 PE=2 SV=1 60 226 6.0E-11
sp|Q8WNV7|DHRS4_PIG Dehydrogenase/reductase SDR family member 4 OS=Sus scrofa GN=DHRS4 PE=1 SV=2 59 248 7.0E-11
sp|P76633|YGCW_ECOLI Uncharacterized oxidoreductase YgcW OS=Escherichia coli (strain K12) GN=ygcW PE=3 SV=2 51 236 8.0E-11
sp|P0AEK3|FABG_SHIFL 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Shigella flexneri GN=fabG PE=3 SV=1 55 258 1.0E-10
sp|P0AEK2|FABG_ECOLI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Escherichia coli (strain K12) GN=fabG PE=1 SV=1 55 258 1.0E-10
sp|P55336|FABG_VIBHA 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Vibrio harveyi GN=fabG PE=3 SV=1 55 258 1.0E-10
sp|P51661|DHI2_MOUSE Corticosteroid 11-beta-dehydrogenase isozyme 2 OS=Mus musculus GN=Hsd11b2 PE=1 SV=2 60 226 1.0E-10
sp|Q1R183|ISFD_CHRSD Sulfoacetaldehyde reductase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=isfD PE=1 SV=1 61 222 2.0E-10
sp|Q09851|AYR1_SCHPO NADPH-dependent 1-acyldihydroxyacetone phosphate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ayr1 PE=3 SV=2 58 245 2.0E-10
sp|P0A2D1|UCPA_SALTY Oxidoreductase UcpA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ucpA PE=3 SV=1 51 247 2.0E-10
sp|P0A2D2|UCPA_SALTI Oxidoreductase UcpA OS=Salmonella typhi GN=ucpA PE=3 SV=1 51 247 2.0E-10
sp|P0A2C9|FABG_SALTY 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fabG PE=1 SV=1 55 258 2.0E-10
sp|P0A2D0|FABG_SALTI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Salmonella typhi GN=fabG PE=3 SV=1 55 258 2.0E-10
sp|Q7TS56|CBR4_RAT Carbonyl reductase family member 4 OS=Rattus norvegicus GN=Cbr4 PE=2 SV=1 61 259 2.0E-10
sp|Q68VY7|FABG_RICTY 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=fabG PE=3 SV=1 56 246 3.0E-10
sp|Q7Z5P4|DHB13_HUMAN 17-beta-hydroxysteroid dehydrogenase 13 OS=Homo sapiens GN=HSD17B13 PE=1 SV=1 31 227 3.0E-10
sp|P50163|TRN2_DATST Tropinone reductase 2 OS=Datura stramonium GN=TR2 PE=1 SV=1 55 248 3.0E-10
sp|Q566S6|DRS7B_DANRE Dehydrogenase/reductase SDR family member 7B OS=Danio rerio GN=dhrs7b PE=2 SV=1 60 246 4.0E-10
sp|Q7M3I4|DHI1_RABIT Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Oryctolagus cuniculus GN=HSD11B1 PE=1 SV=2 55 233 4.0E-10
sp|Q99LB2|DHRS4_MOUSE Dehydrogenase/reductase SDR family member 4 OS=Mus musculus GN=Dhrs4 PE=1 SV=3 59 248 4.0E-10
sp|Q21929|DCXR_CAEEL L-xylulose reductase OS=Caenorhabditis elegans GN=dhs-21 PE=1 SV=2 60 247 4.0E-10
sp|P80365|DHI2_HUMAN Corticosteroid 11-beta-dehydrogenase isozyme 2 OS=Homo sapiens GN=HSD11B2 PE=1 SV=2 60 226 5.0E-10
sp|P72332|NODG_RHIS3 Nodulation protein G OS=Rhizobium sp. (strain N33) GN=nodG PE=3 SV=1 56 258 5.0E-10
sp|Q62730|DHB2_RAT Estradiol 17-beta-dehydrogenase 2 OS=Rattus norvegicus GN=Hsd17b2 PE=2 SV=1 60 228 8.0E-10
sp|O86034|BDHA_RHIME D-beta-hydroxybutyrate dehydrogenase OS=Rhizobium meliloti (strain 1021) GN=bdhA PE=1 SV=1 59 245 9.0E-10
sp|Q5RCF8|DHRS4_PONAB Dehydrogenase/reductase SDR family member 4 OS=Pongo abelii GN=DHRS4 PE=2 SV=3 59 248 1.0E-09
sp|Q9HK58|RHAD_THEAC L-rhamnose 1-dehydrogenase (NADP(+)) OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rhaD PE=1 SV=2 55 271 1.0E-09
sp|P37959|YUSZ_BACSU Uncharacterized oxidoreductase YusZ OS=Bacillus subtilis (strain 168) GN=yusZ PE=3 SV=2 59 226 1.0E-09
sp|Q9BTZ2|DHRS4_HUMAN Dehydrogenase/reductase SDR family member 4 OS=Homo sapiens GN=DHRS4 PE=1 SV=3 59 248 1.0E-09
sp|Q9ZW12|TRNH5_ARATH Tropinone reductase homolog At2g29260, chloroplastic OS=Arabidopsis thaliana GN=At2g29260 PE=2 SV=1 55 270 2.0E-09
sp|G5EGA6|DHRS4_CAEEL Dehydrogenase/reductase SDR family member 4 OS=Caenorhabditis elegans GN=dhrs-4 PE=1 SV=1 55 248 2.0E-09
sp|P16543|DHK2_STRVN Granaticin polyketide synthase putative ketoacyl reductase 2 OS=Streptomyces violaceoruber GN=gra-orf6 PE=3 SV=1 53 202 2.0E-09
sp|P50203|PHAB_ACISR Acetoacetyl-CoA reductase OS=Acinetobacter sp. (strain RA3849) GN=phaB PE=3 SV=1 59 259 2.0E-09
sp|Q6P0H7|CBR4_DANRE Carbonyl reductase family member 4 OS=Danio rerio GN=cbr4 PE=2 SV=1 58 236 3.0E-09
sp|Q8XBJ4|UCPA_ECO57 Oxidoreductase UcpA OS=Escherichia coli O157:H7 GN=ucpA PE=3 SV=2 51 247 3.0E-09
sp|P37440|UCPA_ECOLI Oxidoreductase UcpA OS=Escherichia coli (strain K12) GN=ucpA PE=3 SV=3 51 247 3.0E-09
sp|Q9ZW20|TRNHD_ARATH Tropinone reductase homolog At2g29370 OS=Arabidopsis thaliana GN=At2g29370 PE=3 SV=1 55 247 3.0E-09
sp|P33207|FABG_ARATH 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic OS=Arabidopsis thaliana GN=At1g24360 PE=1 SV=2 60 246 4.0E-09
sp|G0RNA2|LXR4_HYPJQ L-xylo-3-hexulose reductase OS=Hypocrea jecorina (strain QM6a) GN=lxr4 PE=1 SV=1 55 237 4.0E-09
sp|Q68ER2|CBR4_XENTR Carbonyl reductase family member 4 OS=Xenopus tropicalis GN=cbr4 PE=2 SV=1 61 259 5.0E-09
sp|Q6P7J1|DHI1A_XENLA Hydroxysteroid 11-beta-dehydrogenase 1-like protein A OS=Xenopus laevis GN=hsd11b1l-a PE=2 SV=1 55 296 5.0E-09
sp|Q93ZA0|NYC1_ARATH Probable chlorophyll(ide) b reductase NYC1, chloroplastic OS=Arabidopsis thaliana GN=NYC1 PE=1 SV=1 60 276 5.0E-09
sp|P50168|DHI2_SHEEP Corticosteroid 11-beta-dehydrogenase isozyme 2 OS=Ovis aries GN=HSD11B2 PE=2 SV=1 60 226 5.0E-09
sp|P08074|CBR2_MOUSE Carbonyl reductase [NADPH] 2 OS=Mus musculus GN=Cbr2 PE=1 SV=1 56 247 6.0E-09
sp|O05730|VDLC_HELPY Probable short-chain type dehydrogenase/reductase VdlC OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=vdlC PE=3 SV=2 52 233 6.0E-09
sp|P50204|PHAB_PARDE Acetoacetyl-CoA reductase OS=Paracoccus denitrificans GN=phaB PE=3 SV=1 59 245 6.0E-09
sp|P33368|YOHF_ECOLI Uncharacterized oxidoreductase YohF OS=Escherichia coli (strain K12) GN=yohF PE=3 SV=2 59 236 6.0E-09
sp|Q1QU27|ISFD2_CHRSD Sulfoacetaldehyde reductase 2 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=isfD2 PE=1 SV=1 60 249 7.0E-09
sp|P37694|HETN_NOSS1 Ketoacyl reductase HetN OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hetN PE=3 SV=2 56 226 8.0E-09
sp|Q9GKX2|DHRS4_RABIT Dehydrogenase/reductase SDR family member 4 (Fragment) OS=Oryctolagus cuniculus GN=DHRS4 PE=1 SV=1 59 247 8.0E-09
sp|A4IFA7|CBR4_BOVIN Carbonyl reductase family member 4 OS=Bos taurus GN=CBR4 PE=2 SV=1 61 247 8.0E-09
sp|Q9SY73|PTALR_ARATH NADPH-dependent pterin aldehyde reductase OS=Arabidopsis thaliana GN=At1g10310 PE=1 SV=1 60 233 8.0E-09
sp|A6NNS2|DRS7C_HUMAN Dehydrogenase/reductase SDR family member 7C OS=Homo sapiens GN=DHRS7C PE=2 SV=3 29 243 8.0E-09
sp|A4IGM4|DHI1L_XENTR Hydroxysteroid 11-beta-dehydrogenase 1-like protein OS=Xenopus tropicalis GN=hsd11b1l PE=2 SV=1 60 230 8.0E-09
sp|Q8N4T8|CBR4_HUMAN Carbonyl reductase family member 4 OS=Homo sapiens GN=CBR4 PE=1 SV=3 61 259 8.0E-09
sp|P70720|FABG_AGGAC 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Aggregatibacter actinomycetemcomitans GN=fabG PE=3 SV=1 60 236 9.0E-09
sp|P37059|DHB2_HUMAN Estradiol 17-beta-dehydrogenase 2 OS=Homo sapiens GN=HSD17B2 PE=1 SV=1 29 237 1.0E-08
sp|Q93X62|FABG1_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 1, chloroplastic OS=Brassica napus GN=gbkr1 PE=1 SV=1 60 246 1.0E-08
sp|O77667|DHI2_BOVIN Corticosteroid 11-beta-dehydrogenase isozyme 2 OS=Bos taurus GN=HSD11B2 PE=1 SV=1 60 226 1.0E-08
sp|P9WGR5|Y484_MYCTU Uncharacterized oxidoreductase Rv0484c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0484c PE=1 SV=1 48 197 1.0E-08
sp|P9WGR4|Y484_MYCTO Uncharacterized oxidoreductase MT0502 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0502 PE=3 SV=1 48 197 1.0E-08
sp|Q8VID1|DHRS4_RAT Dehydrogenase/reductase SDR family member 4 OS=Rattus norvegicus GN=Dhrs4 PE=2 SV=2 59 248 1.0E-08
sp|Q949M3|FABG3_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 3, chloroplastic OS=Brassica napus GN=bkr3 PE=2 SV=1 60 246 1.0E-08
sp|Q08632|SDR1_PICAB Short-chain type dehydrogenase/reductase OS=Picea abies PE=2 SV=1 56 236 1.0E-08
sp|Q93X67|FABG2_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 2, chloroplastic OS=Brassica napus GN=bkr2 PE=2 SV=1 60 246 1.0E-08
sp|Q9ZKW1|VDLC_HELPJ Probable short-chain type dehydrogenase/reductase VdlC OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=vdlC PE=3 SV=1 59 233 1.0E-08
sp|Q3T001|H17B6_BOVIN 17-beta-hydroxysteroid dehydrogenase type 6 OS=Bos taurus GN=HSD17B6 PE=2 SV=1 61 255 2.0E-08
sp|P28845|DHI1_HUMAN Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Homo sapiens GN=HSD11B1 PE=1 SV=3 55 225 2.0E-08
sp|Q6AYS8|DHB11_RAT Estradiol 17-beta-dehydrogenase 11 OS=Rattus norvegicus GN=Hsd17b11 PE=2 SV=1 56 241 2.0E-08
sp|Q9LHT0|TRNHF_ARATH Tropinone reductase homolog At5g06060 OS=Arabidopsis thaliana GN=At5g06060 PE=2 SV=1 56 245 3.0E-08
sp|P66780|Y1570_MYCBO Uncharacterized oxidoreductase Mb1570 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1570 PE=3 SV=1 43 231 3.0E-08
sp|P9WGS1|Y1543_MYCTU Uncharacterized oxidoreductase Rv1543 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1543 PE=1 SV=1 43 231 3.0E-08
sp|P9WGS0|Y1543_MYCTO Uncharacterized oxidoreductase MT1595 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1595 PE=3 SV=1 43 231 3.0E-08
sp|P73574|FABG1_SYNY3 3-oxoacyl-[acyl-carrier-protein] reductase 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabG1 PE=1 SV=1 59 259 3.0E-08
sp|Q937L4|CPNA_COMTE Cyclopentanol dehydrogenase OS=Comamonas testosteroni GN=cpnA PE=3 SV=1 60 247 3.0E-08
sp|Q8GAV9|CPNA_COMS9 Cyclopentanol dehydrogenase OS=Comamonas sp. (strain NCIMB 9872) GN=cpnA PE=1 SV=1 60 247 3.0E-08
sp|Q93X68|FABG5_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 5, chloroplastic (Fragment) OS=Brassica napus GN=bkr1 PE=2 SV=1 60 246 3.0E-08
sp|Q7SYS6|DHI1B_XENLA Hydroxysteroid 11-beta-dehydrogenase 1-like protein B OS=Xenopus laevis GN=hsd11b1l-b PE=2 SV=1 55 296 3.0E-08
sp|Q9ZW04|TRNH4_ARATH Tropinone reductase homolog At2g29170 OS=Arabidopsis thaliana GN=At2g29170 PE=3 SV=1 56 245 4.0E-08
sp|Q2KIJ5|KDSR_BOVIN 3-ketodihydrosphingosine reductase OS=Bos taurus GN=KDSR PE=2 SV=1 56 233 4.0E-08
sp|Q29529|CBR2_PIG Carbonyl reductase [NADPH] 2 OS=Sus scrofa GN=CBR2 PE=1 SV=1 55 247 4.0E-08
sp|Q8LEU3|NOL_ARATH Chlorophyll(ide) b reductase NOL, chloroplastic OS=Arabidopsis thaliana GN=NOL PE=1 SV=1 60 245 4.0E-08
sp|Q949M2|FABG4_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 4 (Fragment) OS=Brassica napus GN=bkr4 PE=2 SV=1 60 246 5.0E-08
sp|Q6PKH6|DR4L2_HUMAN Dehydrogenase/reductase SDR family member 4-like 2 OS=Homo sapiens GN=DHRS4L2 PE=2 SV=1 59 234 6.0E-08
sp|A7DY56|TRN1_COCOF Tropinone reductase OS=Cochlearia officinalis GN=TR PE=1 SV=1 55 246 6.0E-08
sp|Q9ZW18|SAG13_ARATH Senescence-associated protein 13 OS=Arabidopsis thaliana GN=SAG13 PE=1 SV=1 56 259 6.0E-08
sp|P0A9P9|IDNO_ECOLI Gluconate 5-dehydrogenase OS=Escherichia coli (strain K12) GN=idnO PE=3 SV=1 60 247 6.0E-08
sp|P0A9Q0|IDNO_ECOL6 Gluconate 5-dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=idnO PE=3 SV=1 60 247 6.0E-08
sp|Q92GE0|FABG_RICCN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=fabG PE=3 SV=2 76 246 8.0E-08
sp|Q5M875|DHB13_RAT 17-beta-hydroxysteroid dehydrogenase 13 OS=Rattus norvegicus GN=Hsd17b13 PE=1 SV=1 31 226 8.0E-08
sp|Q91VT4|CBR4_MOUSE Carbonyl reductase family member 4 OS=Mus musculus GN=Cbr4 PE=1 SV=2 61 259 8.0E-08
sp|Q8VCR2|DHB13_MOUSE 17-beta-hydroxysteroid dehydrogenase 13 OS=Mus musculus GN=Hsd17b13 PE=1 SV=2 29 269 1.0E-07
sp|O75452|RDH16_HUMAN Retinol dehydrogenase 16 OS=Homo sapiens GN=RDH16 PE=1 SV=2 55 249 1.0E-07
sp|Q84ST4|NOL_ORYSJ Chlorophyll(ide) b reductase NOL, chloroplastic OS=Oryza sativa subsp. japonica GN=NOL PE=1 SV=1 60 245 1.0E-07
sp|P16232|DHI1_RAT Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Rattus norvegicus GN=Hsd11b1 PE=1 SV=2 55 254 1.0E-07
sp|Q9EQ06|DHB11_MOUSE Estradiol 17-beta-dehydrogenase 11 OS=Mus musculus GN=Hsd17b11 PE=1 SV=1 56 241 2.0E-07
sp|O74470|YQC8_SCHPO Uncharacterized oxidoreductase C1739.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1739.08c PE=3 SV=1 33 225 2.0E-07
sp|Q5NVG2|DHB11_PONAB Estradiol 17-beta-dehydrogenase 11 OS=Pongo abelii GN=HSD17B11 PE=2 SV=1 56 241 2.0E-07
sp|O42866|FABG_SCHPO 3-oxoacyl-[acyl-carrier-protein] reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=oar2 PE=3 SV=1 60 259 2.0E-07
sp|Q6R0J2|DHI1_MESAU Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Mesocricetus auratus GN=HSD11B1 PE=1 SV=3 55 233 2.0E-07
sp|Q1RKB7|FABG_RICBR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Rickettsia bellii (strain RML369-C) GN=fabG PE=3 SV=1 75 260 2.0E-07
sp|P23238|PHBB_ZOORA Acetoacetyl-CoA reductase OS=Zoogloea ramigera GN=phbB PE=3 SV=1 59 245 2.0E-07
sp|P50172|DHI1_MOUSE Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Mus musculus GN=Hsd11b1 PE=1 SV=3 55 226 2.0E-07
sp|Q71R50|DHR11_CHICK Dehydrogenase/reductase SDR family member 11 OS=Gallus gallus GN=DHRS11 PE=2 SV=1 56 228 3.0E-07
sp|Q6PUF4|DHI1L_CHICK Hydroxysteroid 11-beta-dehydrogenase 1-like protein OS=Gallus gallus GN=HSD11B1L PE=2 SV=1 17 233 3.0E-07
sp|Q29608|DHI1_SAISC Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Saimiri sciureus GN=HSD11B1 PE=2 SV=3 55 225 3.0E-07
sp|P35731|FABG_YEAST 3-oxoacyl-[acyl-carrier-protein] reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OAR1 PE=1 SV=1 59 231 3.0E-07
sp|Q06136|KDSR_HUMAN 3-ketodihydrosphingosine reductase OS=Homo sapiens GN=KDSR PE=1 SV=1 56 233 3.0E-07
sp|Q6GV12|KDSR_MOUSE 3-ketodihydrosphingosine reductase OS=Mus musculus GN=Kdsr PE=1 SV=1 56 233 3.0E-07
sp|P9WGS3|EPHD_MYCTU Probable oxidoreductase EphD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ephD PE=1 SV=1 61 226 4.0E-07
sp|P9WGS2|EPHD_MYCTO Probable oxidoreductase EphD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ephD PE=3 SV=1 61 226 4.0E-07
sp|P66778|EPHD_MYCBO Probable oxidoreductase EphD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ephD PE=3 SV=1 61 226 4.0E-07
sp|Q6PUF3|DHI1L_DANRE Hydroxysteroid 11-beta-dehydrogenase 1-like protein OS=Danio rerio GN=hsd11b1l PE=2 SV=1 55 233 4.0E-07
sp|P17611|NODG_AZOBR Nodulation protein G OS=Azospirillum brasilense GN=nodG PE=3 SV=2 59 259 4.0E-07
sp|Q0WRJ2|TC10A_ARATH 3-dehydrosphinganine reductase TSC10A OS=Arabidopsis thaliana GN=TSC10A PE=1 SV=1 59 240 4.0E-07
sp|P50200|HDHA_CLOSO NADP-dependent 7-alpha-hydroxysteroid dehydrogenase OS=Clostridium sordellii PE=1 SV=1 59 271 4.0E-07
sp|Q1JP75|DCXR_BOVIN L-xylulose reductase OS=Bos taurus GN=DCXR PE=2 SV=1 56 269 4.0E-07
sp|P25145|Y432_LISMO Uncharacterized oxidoreductase Lmo0432 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo0432 PE=3 SV=2 60 239 4.0E-07
sp|Q8NBQ5|DHB11_HUMAN Estradiol 17-beta-dehydrogenase 11 OS=Homo sapiens GN=HSD17B11 PE=1 SV=3 56 241 7.0E-07
sp|P28643|FABG_CUPLA 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic OS=Cuphea lanceolata GN=CLKR27 PE=2 SV=1 60 246 8.0E-07
sp|P14697|PHBB_CUPNH Acetoacetyl-CoA reductase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=phbB PE=1 SV=1 59 278 8.0E-07
sp|Q6Q7D1|DHI1L_BOVIN Hydroxysteroid 11-beta-dehydrogenase 1-like protein OS=Bos taurus GN=HSD11B1L PE=2 SV=1 56 253 9.0E-07
sp|Q6QLL4|DHI1_CAVPO Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Cavia porcellus GN=HSD11B1 PE=1 SV=3 55 233 1.0E-06
sp|Q4UK62|FABG_RICFE 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=fabG PE=3 SV=1 95 246 1.0E-06
sp|Q22230|DECR_CAEEL Probable 2,4-dienoyl-CoA reductase 3 OS=Caenorhabditis elegans GN=decr-1.3 PE=3 SV=1 41 228 1.0E-06
sp|Q04520|BUDC_RAOTE Diacetyl reductase [(S)-acetoin forming] OS=Raoultella terrigena GN=budC PE=3 SV=1 59 226 1.0E-06
sp|Q8NEX9|DR9C7_HUMAN Short-chain dehydrogenase/reductase family 9C member 7 OS=Homo sapiens GN=SDR9C7 PE=1 SV=1 46 226 1.0E-06
sp|Q91XV4|DCXR_MESAU L-xylulose reductase OS=Mesocricetus auratus GN=DCXR PE=1 SV=1 56 247 1.0E-06
sp|P51656|DHB1_MOUSE Estradiol 17-beta-dehydrogenase 1 OS=Mus musculus GN=Hsd17b1 PE=2 SV=1 60 223 1.0E-06
sp|P50170|RDH2_RAT Retinol dehydrogenase 2 OS=Rattus norvegicus GN=Rdh2 PE=1 SV=1 61 226 1.0E-06
sp|Q02337|BDH_BOVIN D-beta-hydroxybutyrate dehydrogenase, mitochondrial OS=Bos taurus GN=BDH1 PE=1 SV=2 60 226 1.0E-06
sp|P50165|TRNH_DATST Tropinone reductase homolog OS=Datura stramonium PE=2 SV=1 55 268 1.0E-06
sp|P40288|DHG_BACME Glucose 1-dehydrogenase OS=Bacillus megaterium PE=1 SV=1 55 270 2.0E-06
sp|Q9ZW03|TRNH3_ARATH Tropinone reductase homolog At2g29150 OS=Arabidopsis thaliana GN=At2g29150 PE=1 SV=1 55 259 2.0E-06
sp|Q9LUF2|HSD4B_ARATH 11-beta-hydroxysteroid dehydrogenase-like 4B OS=Arabidopsis thaliana GN=HSD7 PE=2 SV=2 17 229 2.0E-06
sp|P0DKC7|HSD4A_ARATH 11-beta-hydroxysteroid dehydrogenase-like 4A OS=Arabidopsis thaliana GN=HSD4 PE=2 SV=1 17 229 2.0E-06
sp|Q9RPT1|RHLG_PSEAE Rhamnolipids biosynthesis 3-oxoacyl-[acyl-carrier-protein] reductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rhlG PE=1 SV=1 56 259 2.0E-06
sp|O88451|RDH7_MOUSE Retinol dehydrogenase 7 OS=Mus musculus GN=Rdh7 PE=1 SV=1 61 226 2.0E-06
sp|Q45219|Y2146_BRADU Probable short-chain type dehydrogenase/reductase blr2146 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=blr2146 PE=3 SV=2 51 244 3.0E-06
sp|A9UM79|DRS7C_XENTR Dehydrogenase/reductase SDR family member 7C OS=Xenopus tropicalis GN=dhrs7c PE=2 SV=1 52 243 3.0E-06
sp|Q9STY7|HSD3_ARATH 11-beta-hydroxysteroid dehydrogenase-like 3 OS=Arabidopsis thaliana GN=HSD3 PE=3 SV=1 60 229 3.0E-06
sp|P39482|DHG1_BACME Glucose 1-dehydrogenase 1 OS=Bacillus megaterium GN=gdhI PE=2 SV=1 55 270 3.0E-06
sp|Q48436|BUDC_KLEPN Diacetyl reductase [(S)-acetoin forming] OS=Klebsiella pneumoniae GN=budC PE=1 SV=2 59 233 3.0E-06
sp|Q9STY8|HSD2_ARATH 11-beta-hydroxysteroid dehydrogenase-like 2 OS=Arabidopsis thaliana GN=HSD2 PE=2 SV=1 36 229 3.0E-06
sp|Q8P3K4|FUCDH_XANCP 2-keto-3-deoxy-L-fuconate dehydrogenase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=XCC4067 PE=1 SV=1 55 225 3.0E-06
sp|P9WGQ5|Y927C_MYCTU Uncharacterized oxidoreductase Rv0927c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0927c PE=1 SV=1 59 219 4.0E-06
sp|P9WGQ4|Y927C_MYCTO Uncharacterized oxidoreductase MT0954 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0954 PE=3 SV=1 59 219 4.0E-06
sp|B8H1Z0|XDH_CAUCN D-xylose 1-dehydrogenase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=xylB PE=1 SV=1 124 236 4.0E-06
sp|P07772|BEND_ACIAD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=benD PE=3 SV=2 60 266 4.0E-06
sp|O34717|FADH_BACSU Probable 2,4-dienoyl-CoA reductase OS=Bacillus subtilis (strain 168) GN=fadH PE=2 SV=1 60 270 4.0E-06
sp|Q56840|HCDR_XANP2 2-(R)-hydroxypropyl-CoM dehydrogenase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=xecD PE=1 SV=3 59 249 5.0E-06
sp|P37769|KDUD_ECOLI 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase OS=Escherichia coli (strain K12) GN=kduD PE=1 SV=2 36 249 5.0E-06
sp|Q9T0G0|HSD5_ARATH 11-beta-hydroxysteroid dehydrogenase-like 5 OS=Arabidopsis thaliana GN=HSD5 PE=2 SV=1 60 229 5.0E-06
sp|Q5BL28|DS7CB_DANRE Dehydrogenase/reductase SDR family member 7C-B OS=Danio rerio GN=dhrs7cb PE=2 SV=1 60 265 6.0E-06
sp|Q92EK7|Y452_LISIN Uncharacterized oxidoreductase Lin0452 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lin0452 PE=3 SV=1 60 212 6.0E-06
sp|Q5BE65|TSC10_EMENI 3-ketodihydrosphingosine reductase tsc10 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tsc10 PE=3 SV=2 41 230 6.0E-06
sp|Q4JK73|DHB11_MACFA Estradiol 17-beta-dehydrogenase 11 OS=Macaca fascicularis GN=HSD17B11 PE=2 SV=1 56 241 6.0E-06
sp|Q9BY49|PECR_HUMAN Peroxisomal trans-2-enoyl-CoA reductase OS=Homo sapiens GN=PECR PE=1 SV=2 44 225 7.0E-06
sp|Q4L8Y1|Y0585_STAHJ Uncharacterized oxidoreductase SH0585 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH0585 PE=3 SV=1 55 231 7.0E-06
sp|Q3ZBV9|DHR11_BOVIN Dehydrogenase/reductase SDR family member 11 OS=Bos taurus GN=DHRS11 PE=2 SV=1 59 228 9.0E-06
sp|Q988B7|PLDH_RHILO Pyridoxal 4-dehydrogenase OS=Rhizobium loti (strain MAFF303099) GN=pldh-t PE=1 SV=1 56 260 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 188 210 22
3 291 313 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|579550
MDYALYLAHHWQYPSLVLLALGALSVLRLLYQTLSVLLQTFVLQGKSLSKFGAKKGAWAVVTGCTDGLGKEFAFQ
LAQAGFNVLLVARNVDLLNSTAQEIQTKFNVKTQIHVIDFVKADTREYAVFAETLQPLDIGVLVNNVGKSHAMPA
YLVDTPLDEVTDIVTINVKATVQVTYAVLPGMVQRKRGLILNIGSFAGAVPSPMLATYSGTKAFLATFTSALAEE
VRKDNIVVEHVNTYFVVSKLSKIRKASALVPMPRAYVRSVLGKIGLACGAGFSGRPDTSTPYWSHALLDWLMTVV
GLPGVFIGYTHRLHQDIRRRALRKAERERKGQ*
Coding >Agabi119p4|579550
ATGGACTACGCACTCTATCTTGCCCACCATTGGCAATACCCATCTTTGGTGCTGTTGGCGCTTGGCGCTTTGTCT
GTCTTGCGCCTGCTGTACCAAACATTGTCTGTTTTGTTGCAGACATTTGTTCTTCAAGGCAAAAGCTTGTCCAAA
TTTGGCGCGAAAAAAGGTGCATGGGCAGTAGTGACCGGGTGTACGGATGGTCTGGGGAAGGAATTTGCGTTTCAA
CTTGCCCAAGCTGGATTCAATGTACTCCTCGTTGCGCGTAACGTTGACTTGTTGAACTCGACTGCTCAAGAGATT
CAGACCAAATTCAATGTCAAAACTCAAATTCACGTCATTGACTTTGTAAAGGCCGATACTCGAGAATATGCAGTA
TTTGCGGAAACGCTACAACCCCTTGACATTGGTGTACTTGTCAACAATGTCGGCAAGTCGCATGCCATGCCAGCC
TACCTTGTCGACACACCCCTGGACGAGGTTACAGATATTGTAACTATCAATGTCAAGGCTACAGTTCAGGTCACG
TATGCGGTCCTTCCAGGAATGGTCCAGAGGAAACGAGGTTTGATTTTGAATATTGGATCATTCGCCGGGGCGGTG
CCATCACCCATGTTGGCCACCTATTCGGGTACCAAGGCGTTCCTCGCTACGTTTACGAGTGCCCTTGCCGAGGAG
GTGCGGAAAGACAACATTGTGGTTGAGCACGTCAACACGTACTTTGTGGTCTCGAAGCTGTCAAAGATCCGCAAG
GCGAGTGCCCTTGTGCCGATGCCGAGGGCGTACGTTAGATCTGTGTTGGGCAAGATTGGGCTGGCATGCGGCGCT
GGGTTCAGCGGGCGCCCTGACACTTCTACGCCCTACTGGTCGCATGCGCTGCTGGACTGGCTGATGACGGTGGTT
GGGCTGCCCGGTGTGTTTATCGGGTACACGCACCGGCTGCACCAGGACATCCGGCGCCGAGCATTACGCAAGGCA
GAGAGGGAGCGGAAGGGGCAGTGA
Transcript >Agabi119p4|579550
ATGGACTACGCACTCTATCTTGCCCACCATTGGCAATACCCATCTTTGGTGCTGTTGGCGCTTGGCGCTTTGTCT
GTCTTGCGCCTGCTGTACCAAACATTGTCTGTTTTGTTGCAGACATTTGTTCTTCAAGGCAAAAGCTTGTCCAAA
TTTGGCGCGAAAAAAGGTGCATGGGCAGTAGTGACCGGGTGTACGGATGGTCTGGGGAAGGAATTTGCGTTTCAA
CTTGCCCAAGCTGGATTCAATGTACTCCTCGTTGCGCGTAACGTTGACTTGTTGAACTCGACTGCTCAAGAGATT
CAGACCAAATTCAATGTCAAAACTCAAATTCACGTCATTGACTTTGTAAAGGCCGATACTCGAGAATATGCAGTA
TTTGCGGAAACGCTACAACCCCTTGACATTGGTGTACTTGTCAACAATGTCGGCAAGTCGCATGCCATGCCAGCC
TACCTTGTCGACACACCCCTGGACGAGGTTACAGATATTGTAACTATCAATGTCAAGGCTACAGTTCAGGTCACG
TATGCGGTCCTTCCAGGAATGGTCCAGAGGAAACGAGGTTTGATTTTGAATATTGGATCATTCGCCGGGGCGGTG
CCATCACCCATGTTGGCCACCTATTCGGGTACCAAGGCGTTCCTCGCTACGTTTACGAGTGCCCTTGCCGAGGAG
GTGCGGAAAGACAACATTGTGGTTGAGCACGTCAACACGTACTTTGTGGTCTCGAAGCTGTCAAAGATCCGCAAG
GCGAGTGCCCTTGTGCCGATGCCGAGGGCGTACGTTAGATCTGTGTTGGGCAAGATTGGGCTGGCATGCGGCGCT
GGGTTCAGCGGGCGCCCTGACACTTCTACGCCCTACTGGTCGCATGCGCTGCTGGACTGGCTGATGACGGTGGTT
GGGCTGCCCGGTGTGTTTATCGGGTACACGCACCGGCTGCACCAGGACATCCGGCGCCGAGCATTACGCAAGGCA
GAGAGGGAGCGGAAGGGGCAGTGA
Gene >Agabi119p4|579550
ATGGACTACGCACTCTATCTTGGTGAGTCGCATAATTTACAGATTGATTGCAGCTGTGTTGAAAGAGAGCAGCCC
ACCATTGGCAATACCCATCTTTGGTGCTGTTGGCGCTTGGCGCTTTGTCTGTCTTGCGCCTGCTGTACCAAACAT
TGTCTGTTTTGTTGCAGACATTTGTTCTTCAAGGCAAAAGCGTGCGTGTATAGCCATGTTTCCATGATCGGGTAT
TTGATTAGCCTCCCTCAAGTTGTCCAAATTTGGCGCGAAAAAAGGTGCATGGGCAGTAGTGACCGGGTGTACGGA
TGGTCTGGGGAAGGAATTTGCGTTTCAACTTGCCCAAGCTGGATTCAATGTACTCCTCGTTGCGCGTAACGTTGA
CTTGTTGAACTCGACTGCTCAAGAGATTCGTATGTTTTTTTCTTTACGGTCAAGTGTGGCTCGCGGGTAGCTAAC
TACGCCCCACAGAGACCAAATTCAATGTCAAAACTCAAATTCACGTCATTGACTTTGTAAAGGCCGATACTCGAG
AATATGCAGTATTTGCGGAAACGCTACAACCCCTTGACATTGGTGTACTTGGTGAGTAACGCGCTCCGTTGGTGT
TCACACAGCTGCTGACTGTGGTGCAGTCAACAATGTCGGCAAGTCGCATGCCATGCCAGCCTACCTTGTCGACAC
ACCCCTGGACGAGGTTACAGATATTGTAACTATCAATGTCAAGGCTACAGTTCAGGTCACGTATGCGGTCCTTCC
AGGAATGGTCCAGAGGTGCGTGGATTGTTCTGGAAGAAAGGCAAGGCTGACAATCGGATAGGAAACGAGGTTTGA
TTTTGAATATTGGATCATTCGCCGGGGCGGTGCCATCACCCATGTTGGCCACCTATTCGGGTACCAAGGCGTTCC
TCGCTACGTTTACGAGTGCCCTTGCCGAGGAGGTGCGGAAAGACAACATTGTGGTTGAGCACGTCAACACGTACT
TTGTGGTAAGTGTAGCGCACCTTGTGCGTGGTTGCTGTATACTTATGCGCCATTGCAGGTCTCGAAGCTGTCAAA
GATCCGCAAGGCGAGTGCCCTTGTGCCGATGCCGAGGGCGTACGTTAGATCTGTGTTGGGCAAGATTGGGCTGGC
ATGCGGCGCTGGGTTCAGCGGGCGCCCTGACACTTCTACGCCCTACTGGTCGCATGCGCTGCTGGACTGGCTGAT
GACGGTGGTTGGGCTGCCCGGTGTGTTTATCGGGTACACGCACCGGCTGCACCAGGACATCCGGCGCCGAGCATT
ACGCAAGGCAGAGAGGGAGCGGAAGGGGCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail