Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|578500
Gene name
Locationscaffold_02:644396..645714
Strand-
Gene length (bp)1318
Transcript length (bp)1029
Coding sequence length (bp)1029
Protein length (aa) 343

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 1.5E-20 28 176
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 8.3E-16 34 158
PF08659 KR KR domain 9.0E-06 29 134

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5F389|WWOX_CHICK WW domain-containing oxidoreductase OS=Gallus gallus GN=WWOX PE=2 SV=2 11 303 9.0E-26
sp|Q9NZC7|WWOX_HUMAN WW domain-containing oxidoreductase OS=Homo sapiens GN=WWOX PE=1 SV=1 11 328 2.0E-24
sp|Q5R9W5|WWOX_PONAB WW domain-containing oxidoreductase OS=Pongo abelii GN=WWOX PE=2 SV=1 11 328 5.0E-24
sp|Q8NBN7|RDH13_HUMAN Retinol dehydrogenase 13 OS=Homo sapiens GN=RDH13 PE=1 SV=2 22 335 6.0E-24
sp|Q8CEE7|RDH13_MOUSE Retinol dehydrogenase 13 OS=Mus musculus GN=Rdh13 PE=1 SV=1 22 248 2.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5F389|WWOX_CHICK WW domain-containing oxidoreductase OS=Gallus gallus GN=WWOX PE=2 SV=2 11 303 9.0E-26
sp|Q9NZC7|WWOX_HUMAN WW domain-containing oxidoreductase OS=Homo sapiens GN=WWOX PE=1 SV=1 11 328 2.0E-24
sp|Q5R9W5|WWOX_PONAB WW domain-containing oxidoreductase OS=Pongo abelii GN=WWOX PE=2 SV=1 11 328 5.0E-24
sp|Q8NBN7|RDH13_HUMAN Retinol dehydrogenase 13 OS=Homo sapiens GN=RDH13 PE=1 SV=2 22 335 6.0E-24
sp|Q8CEE7|RDH13_MOUSE Retinol dehydrogenase 13 OS=Mus musculus GN=Rdh13 PE=1 SV=1 22 248 2.0E-23
sp|Q91WL8|WWOX_MOUSE WW domain-containing oxidoreductase OS=Mus musculus GN=Wwox PE=1 SV=1 11 310 2.0E-22
sp|Q6UX07|DHR13_HUMAN Dehydrogenase/reductase SDR family member 13 OS=Homo sapiens GN=DHRS13 PE=2 SV=1 11 301 3.0E-22
sp|Q96NR8|RDH12_HUMAN Retinol dehydrogenase 12 OS=Homo sapiens GN=RDH12 PE=1 SV=3 5 293 4.0E-22
sp|Q8BYK4|RDH12_MOUSE Retinol dehydrogenase 12 OS=Mus musculus GN=Rdh12 PE=2 SV=1 22 250 2.0E-21
sp|P59837|RDH12_BOVIN Retinol dehydrogenase 12 OS=Bos taurus GN=RDH12 PE=2 SV=1 5 250 7.0E-21
sp|Q9VLU5|WWOX_DROME WW domain-containing oxidoreductase OS=Drosophila melanogaster GN=Wwox PE=2 SV=1 24 303 8.0E-21
sp|Q9ERI6|RDH14_MOUSE Retinol dehydrogenase 14 OS=Mus musculus GN=Rdh14 PE=1 SV=1 25 248 9.0E-21
sp|Q5SS80|DHR13_MOUSE Dehydrogenase/reductase SDR family member 13 OS=Mus musculus GN=Dhrs13 PE=1 SV=1 24 314 7.0E-20
sp|Q803A8|WWOX_DANRE WW domain-containing oxidoreductase OS=Danio rerio GN=wwox PE=2 SV=1 24 297 1.0E-19
sp|O74959|YJCD_SCHPO Uncharacterized oxidoreductase C736.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC736.13 PE=3 SV=1 24 321 2.0E-19
sp|Q17QU7|DHR13_BOVIN Dehydrogenase/reductase SDR family member 13 OS=Bos taurus GN=DHRS13 PE=2 SV=1 11 301 5.0E-19
sp|Q9HBH5|RDH14_HUMAN Retinol dehydrogenase 14 OS=Homo sapiens GN=RDH14 PE=1 SV=1 25 248 7.0E-19
sp|Q8TC12|RDH11_HUMAN Retinol dehydrogenase 11 OS=Homo sapiens GN=RDH11 PE=1 SV=2 24 253 1.0E-18
sp|Q9QYF1|RDH11_MOUSE Retinol dehydrogenase 11 OS=Mus musculus GN=Rdh11 PE=1 SV=2 22 278 4.0E-18
sp|Q8N5I4|DHRSX_HUMAN Dehydrogenase/reductase SDR family member on chromosome X OS=Homo sapiens GN=DHRSX PE=2 SV=2 27 294 1.0E-15
sp|A2RVM0|TIC32_ARATH Short-chain dehydrogenase TIC 32, chloroplastic OS=Arabidopsis thaliana GN=TIC32 PE=2 SV=1 29 314 9.0E-12
sp|Q8VBZ0|DHRSX_MOUSE Dehydrogenase/reductase SDR family member on chromosome X homolog OS=Mus musculus GN=Dhrsx PE=1 SV=2 28 325 1.0E-11
sp|Q6RVV4|TIC32_PEA Short-chain dehydrogenase TIC 32, chloroplastic OS=Pisum sativum GN=TIC32 PE=1 SV=1 29 278 4.0E-11
sp|Q8K354|CBR3_MOUSE Carbonyl reductase [NADPH] 3 OS=Mus musculus GN=Cbr3 PE=1 SV=1 28 283 2.0E-10
sp|P48758|CBR1_MOUSE Carbonyl reductase [NADPH] 1 OS=Mus musculus GN=Cbr1 PE=1 SV=3 31 300 3.0E-10
sp|Q92247|BLI4_NEUCR Putative oxidoreductase bli-4, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=bli-4 PE=1 SV=1 24 245 7.0E-10
sp|Q42536|PORA_ARATH Protochlorophyllide reductase A, chloroplastic OS=Arabidopsis thaliana GN=PORA PE=1 SV=2 25 151 2.0E-09
sp|A0PJE2|DHR12_HUMAN Dehydrogenase/reductase SDR family member 12 OS=Homo sapiens GN=DHRS12 PE=2 SV=2 17 275 3.0E-09
sp|O75828|CBR3_HUMAN Carbonyl reductase [NADPH] 3 OS=Homo sapiens GN=CBR3 PE=1 SV=3 28 283 6.0E-09
sp|Q28960|CBR1_PIG Carbonyl reductase [NADPH] 1 OS=Sus scrofa GN=CBR1 PE=1 SV=3 28 246 1.0E-08
sp|Q39617|POR_CHLRE Protochlorophyllide reductase, chloroplastic OS=Chlamydomonas reinhardtii GN=PORA PE=3 SV=1 9 141 1.0E-08
sp|O80333|POR_MARPA Protochlorophyllide reductase, chloroplastic OS=Marchantia paleacea GN=PORA PE=2 SV=1 18 172 1.0E-08
sp|P16152|CBR1_HUMAN Carbonyl reductase [NADPH] 1 OS=Homo sapiens GN=CBR1 PE=1 SV=3 31 301 2.0E-08
sp|Q8MI29|CBR1_MACFA Carbonyl reductase [NADPH] 1 OS=Macaca fascicularis GN=CBR1 PE=2 SV=1 28 278 2.0E-08
sp|Q5RCU5|CBR1_PONAB Carbonyl reductase [NADPH] 1 OS=Pongo abelii GN=CBR1 PE=2 SV=3 31 301 3.0E-08
sp|Q41249|PORA_CUCSA Protochlorophyllide reductase, chloroplastic OS=Cucumis sativus GN=PORA PE=2 SV=1 15 141 1.0E-07
sp|P72332|NODG_RHIS3 Nodulation protein G OS=Rhizobium sp. (strain N33) GN=nodG PE=3 SV=1 24 246 2.0E-07
sp|Q8W3D9|PORB_ORYSJ Protochlorophyllide reductase B, chloroplastic OS=Oryza sativa subsp. japonica GN=PORB PE=2 SV=1 18 151 2.0E-07
sp|Q53877|DNRU_STRS5 Putative daunorubicin C-13 ketoreductase DnrU OS=Streptomyces sp. (strain C5) PE=3 SV=1 25 142 2.0E-07
sp|O48741|PORC_ARATH Protochlorophyllide reductase C, chloroplastic OS=Arabidopsis thaliana GN=PORC PE=1 SV=1 18 141 3.0E-07
sp|Q9SDT1|POR_DAUCA Protochlorophyllide reductase, chloroplastic OS=Daucus carota GN=POR1 PE=2 SV=1 25 141 4.0E-07
sp|P46331|YXBG_BACSU Uncharacterized oxidoreductase YxbG OS=Bacillus subtilis (strain 168) GN=yxbG PE=3 SV=2 25 158 4.0E-07
sp|Q01289|POR_PEA Protochlorophyllide reductase, chloroplastic OS=Pisum sativum GN=3PCR PE=1 SV=1 25 141 5.0E-07
sp|Q6P7J1|DHI1A_XENLA Hydroxysteroid 11-beta-dehydrogenase 1-like protein A OS=Xenopus laevis GN=hsd11b1l-a PE=2 SV=1 24 147 5.0E-07
sp|Q42850|PORB_HORVU Protochlorophyllide reductase B, chloroplastic OS=Hordeum vulgare GN=PORB PE=2 SV=1 25 151 6.0E-07
sp|Q9ZAU1|DNRU_STRPE Putative daunorubicin C-13 ketoreductase DnrU OS=Streptomyces peucetius GN=dnrU PE=3 SV=1 25 142 1.0E-06
sp|P31808|YCIK_ECOLI Uncharacterized oxidoreductase YciK OS=Escherichia coli (strain K12) GN=yciK PE=1 SV=3 25 139 2.0E-06
sp|P21218|PORB_ARATH Protochlorophyllide reductase B, chloroplastic OS=Arabidopsis thaliana GN=PORB PE=1 SV=3 25 141 2.0E-06
sp|P47844|CBR1_RABIT Carbonyl reductase [NADPH] 1 OS=Oryctolagus cuniculus GN=CBR1 PE=2 SV=2 28 301 3.0E-06
sp|Q9Y140|DHRS7_DROME Dehydrogenase/reductase SDR family protein 7-like OS=Drosophila melanogaster GN=CG7601 PE=2 SV=1 22 250 3.0E-06
sp|Q3SZD7|CBR1_BOVIN Carbonyl reductase [NADPH] 1 OS=Bos taurus GN=CBR1 PE=2 SV=1 31 281 4.0E-06
sp|Q6QLL4|DHI1_CAVPO Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Cavia porcellus GN=HSD11B1 PE=1 SV=3 25 157 6.0E-06
sp|O88736|DHB7_MOUSE 3-keto-steroid reductase OS=Mus musculus GN=Hsd17b7 PE=1 SV=1 28 118 6.0E-06
sp|P50172|DHI1_MOUSE Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Mus musculus GN=Hsd11b1 PE=1 SV=3 25 154 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|578500
MGKKSIFGFLYDQLRRVPDVIQTDLKDKTVVVVGANTGIGFQAAQHFARMNAGRLILACRSEKKGQAAVDRLKAA
TGYSKAELWLVDLSTFSSVQEFADRTVKDLERLDILLLNAAVLHREDGSYTTTKDGWETTLHVNDLSFTLLSFLL
LPLMVDTAKKFNTHPRLVTVTSELHFMTKFEDKIFESPNAIEFMSSKDYCTPQIMKTRYPDTKLLNVFFTRALSN
RSKHQPVVFNCVNPGFCRSELLRDAKGMVTKLMSLLLARSAEEGSRQLIWAAIGLPESGSLDEMRGAYVNRASIE
EPSDFVLGEEGKKREDKLYADTISIIQKVDPRVKEIESQYLI*
Coding >Agabi119p4|578500
ATGGGCAAGAAAAGCATTTTCGGCTTCCTCTATGATCAACTTCGTCGAGTTCCCGATGTCATTCAGACAGATCTC
AAGGACAAGACGGTCGTCGTTGTTGGCGCCAATACTGGTATTGGTTTTCAAGCTGCACAACACTTCGCGAGAATG
AATGCCGGAAGACTTATTCTTGCTTGTCGCAGCGAGAAGAAAGGCCAAGCAGCTGTGGATCGTTTGAAAGCAGCC
ACTGGCTATTCCAAGGCAGAATTGTGGTTGGTTGACCTTTCTACATTCTCGTCCGTCCAAGAATTCGCCGATCGG
ACCGTGAAAGACCTAGAGAGGTTGGATATTCTGTTGTTGAATGCTGCTGTTCTACATCGAGAAGATGGATCATAT
ACCACAACTAAAGATGGATGGGAAACGACGCTCCACGTGAACGACCTTTCTTTCACACTGCTCTCTTTTTTGTTG
CTCCCTCTTATGGTTGACACCGCCAAGAAGTTCAACACACATCCAAGGCTCGTCACCGTCACAAGCGAGCTTCAC
TTTATGACGAAGTTCGAGGATAAAATATTTGAAAGTCCTAATGCAATCGAGTTCATGAGCAGCAAAGATTACTGT
ACGCCCCAAATCATGAAAACCCGTTATCCTGATACCAAGCTTCTGAATGTATTCTTCACTCGTGCTCTCAGCAAC
CGATCGAAACACCAGCCTGTTGTCTTCAATTGTGTTAACCCTGGCTTCTGTCGTTCTGAACTCCTCAGAGATGCA
AAGGGCATGGTCACCAAGCTGATGTCATTATTATTAGCCCGGAGTGCTGAAGAGGGTAGTCGCCAATTAATCTGG
GCTGCTATCGGTCTTCCGGAGAGTGGGTCCTTGGATGAAATGAGAGGCGCATACGTCAACAGAGCGAGCATAGAA
GAGCCTTCAGATTTTGTCCTTGGGGAAGAGGGTAAGAAGAGAGAGGATAAGCTATATGCCGACACGATTTCTATC
ATTCAAAAAGTGGATCCGCGCGTGAAAGAGATAGAGTCACAGTATCTGATCTAA
Transcript >Agabi119p4|578500
ATGGGCAAGAAAAGCATTTTCGGCTTCCTCTATGATCAACTTCGTCGAGTTCCCGATGTCATTCAGACAGATCTC
AAGGACAAGACGGTCGTCGTTGTTGGCGCCAATACTGGTATTGGTTTTCAAGCTGCACAACACTTCGCGAGAATG
AATGCCGGAAGACTTATTCTTGCTTGTCGCAGCGAGAAGAAAGGCCAAGCAGCTGTGGATCGTTTGAAAGCAGCC
ACTGGCTATTCCAAGGCAGAATTGTGGTTGGTTGACCTTTCTACATTCTCGTCCGTCCAAGAATTCGCCGATCGG
ACCGTGAAAGACCTAGAGAGGTTGGATATTCTGTTGTTGAATGCTGCTGTTCTACATCGAGAAGATGGATCATAT
ACCACAACTAAAGATGGATGGGAAACGACGCTCCACGTGAACGACCTTTCTTTCACACTGCTCTCTTTTTTGTTG
CTCCCTCTTATGGTTGACACCGCCAAGAAGTTCAACACACATCCAAGGCTCGTCACCGTCACAAGCGAGCTTCAC
TTTATGACGAAGTTCGAGGATAAAATATTTGAAAGTCCTAATGCAATCGAGTTCATGAGCAGCAAAGATTACTGT
ACGCCCCAAATCATGAAAACCCGTTATCCTGATACCAAGCTTCTGAATGTATTCTTCACTCGTGCTCTCAGCAAC
CGATCGAAACACCAGCCTGTTGTCTTCAATTGTGTTAACCCTGGCTTCTGTCGTTCTGAACTCCTCAGAGATGCA
AAGGGCATGGTCACCAAGCTGATGTCATTATTATTAGCCCGGAGTGCTGAAGAGGGTAGTCGCCAATTAATCTGG
GCTGCTATCGGTCTTCCGGAGAGTGGGTCCTTGGATGAAATGAGAGGCGCATACGTCAACAGAGCGAGCATAGAA
GAGCCTTCAGATTTTGTCCTTGGGGAAGAGGGTAAGAAGAGAGAGGATAAGCTATATGCCGACACGATTTCTATC
ATTCAAAAAGTGGATCCGCGCGTGAAAGAGATAGAGTCACAGTATCTGATCTAA
Gene >Agabi119p4|578500
ATGGGCAAGAAAAGCATTTTCGGCTTCCTCTATGATCAACTTCGTCGAGTTCCCGATGTCATTCAGACAGATCTC
AAGGACAAGACGGTCGTCGTTGTTGGCGCCAATACTGGTATTGGTTTTCAAGCTGCACAACACTTCGCGAGAATG
AATGCCGGAAGACTTATTCTTGCTTGTCGCAGCGAGAAGAAAGGCCAAGCAGCTGTGGATCGTCAGTACATTATT
TTTAGTTCTCAGTTTTTTGACTAGTCGATTAATACGCATGATCCCAAATGCAGGTTTGAAAGCAGCCACTGGCTA
TTCCAAGGCAGAATTGTGGTTGGTTGACCTTTCTACATTCTCGTCCGTCCAAGAATTCGCCGATCGGACCGTGAA
AGACCTAGAGAGGTTGGATATTCTGTTGTTGAATGCTGCTGTTCTACATCGAGAAGATGGATCATATACCACAAC
TAAAGATGGATGGGAAACGACGTACGTGCTCATCTGCCAATCATGATGGAACGTTAATGGTTGAATATGTCCAAC
TAGGCTCCACGTGAACGACCTTTCTTTCACACTGCTCTCTTTTTTGTTGCTCCCTCTTATGGTTGACACCGCCAA
GAAGTTCAACACACATCCAAGGCTCGTCACCGTCACAAGCGAGCTTCACTTTATGACGAAGTTCGAGGATAAAAT
ATTTGAAAGTCCTAATGCAATCGAGTTCATGAGCAGCAAAGATTACTGTACGCCCCAGTGAGTTGGCATGTAAAA
CGTCGACTCGGCAAAAAAACTGATAACGAACCAGAATCATGAAAACCCGTTATCCTGATACCAAGCGTGAGTTGT
TCCCTACATTCACTGGACCTTTTGTTGTTGATATTCTTTTGCTAGTTCTGAATGTATTCTTCACTCGTGCTCTCA
GCAACCGATCGAAACACCAGCCTGTTGTCTTCAATTGTGTTAACCCTGGCTTCTGTCGTTCTGAACTCCTCAGAG
ATGCAAAGGGCATGGTCACCAAGCTGATGTCATTATTATTAGCCCGGAGTGCTGAAGAGGGTAGTCGCCAATTAA
TCTGGGCTGCTATCGGTCTTCCGGAGAGTGGGTCCTTGGATGAAATGAGAGGCGCATACGTCAACAGAGCGAGCA
TAGAAGAGCCTTCAGATTTTGTCCTTGGGGAAGAGGGTAAGAAGAGAGAGGATAAGCTATATGTGAGTTCAAATC
AAATACTTCATGTATAAACATTTTTGACAATACATTTTTCCGGCAGGCCGACACGATTTCTATCATTCAAAAAGT
GGATCCGCGCGTGAAAGAGATAGAGTCACAGTATCTGATCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail