Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|577700
Gene name
Locationscaffold_02:575048..578577
Strand+
Gene length (bp)3529
Transcript length (bp)2349
Coding sequence length (bp)2349
Protein length (aa) 783

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11718 CPSF73-100_C Pre-mRNA 3'-end-processing endonuclease polyadenylation factor C-term 7.5E-67 482 715
PF10996 Beta-Casp Beta-Casp domain 4.6E-28 244 370
PF00753 Lactamase_B Metallo-beta-lactamase superfamily 1.9E-18 19 189
PF16661 Lactamase_B_6 Metallo-beta-lactamase superfamily domain 1.3E-16 56 190
PF07521 RMMBL Zn-dependent metallo-hydrolase RNA specificity domain 3.5E-09 384 447
PF12706 Lactamase_B_2 Beta-lactamase superfamily domain 2.5E-06 56 205

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CM88|YSH1_CRYNJ Endoribonuclease YSH1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=YSH1 PE=3 SV=1 3 724 0.0E+00
sp|Q6CUI5|YSH1_KLULA Endoribonuclease YSH1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=YSH1 PE=3 SV=1 12 603 0.0E+00
sp|Q4WRC2|YSH1_ASPFU Endoribonuclease ysh1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ysh1 PE=3 SV=1 7 717 0.0E+00
sp|Q59P50|YSH1_CANAL Endoribonuclease YSH1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=YSH1 PE=3 SV=1 12 719 0.0E+00
sp|Q74ZC0|YSH1_ASHGO Endoribonuclease YSH1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=YSH1 PE=3 SV=2 12 717 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CM88|YSH1_CRYNJ Endoribonuclease YSH1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=YSH1 PE=3 SV=1 3 724 0.0E+00
sp|Q6CUI5|YSH1_KLULA Endoribonuclease YSH1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=YSH1 PE=3 SV=1 12 603 0.0E+00
sp|Q4WRC2|YSH1_ASPFU Endoribonuclease ysh1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ysh1 PE=3 SV=1 7 717 0.0E+00
sp|Q59P50|YSH1_CANAL Endoribonuclease YSH1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=YSH1 PE=3 SV=1 12 719 0.0E+00
sp|Q74ZC0|YSH1_ASHGO Endoribonuclease YSH1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=YSH1 PE=3 SV=2 12 717 0.0E+00
sp|Q06224|YSH1_YEAST Endoribonuclease YSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YSH1 PE=1 SV=1 12 717 0.0E+00
sp|Q8WZS6|YSH1_NEUCR Endoribonuclease ysh-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ysh-1 PE=3 SV=1 12 645 0.0E+00
sp|Q86A79|CPSF3_DICDI Cleavage and polyadenylation specificity factor subunit 3 OS=Dictyostelium discoideum GN=cpsf3 PE=3 SV=1 3 722 0.0E+00
sp|Q9VE51|CPSF3_DROME Cleavage and polyadenylation specificity factor 73 OS=Drosophila melanogaster GN=Cpsf73 PE=1 SV=2 3 588 0.0E+00
sp|Q6FUA5|YSH1_CANGA Endoribonuclease YSH1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=YSH1 PE=3 SV=1 12 717 0.0E+00
sp|Q4PEJ3|YSH1_USTMA Endoribonuclease YSH1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=YSH1 PE=3 SV=1 7 721 0.0E+00
sp|P0CM89|YSH1_CRYNB Endoribonuclease YSH1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=YSH1 PE=3 SV=1 3 724 0.0E+00
sp|O13794|YSH1_SCHPO Endoribonuclease ysh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ysh1 PE=3 SV=2 4 773 0.0E+00
sp|P79101|CPSF3_BOVIN Cleavage and polyadenylation specificity factor subunit 3 OS=Bos taurus GN=CPSF3 PE=1 SV=1 3 595 0.0E+00
sp|Q9UKF6|CPSF3_HUMAN Cleavage and polyadenylation specificity factor subunit 3 OS=Homo sapiens GN=CPSF3 PE=1 SV=1 3 595 0.0E+00
sp|Q9QXK7|CPSF3_MOUSE Cleavage and polyadenylation specificity factor subunit 3 OS=Mus musculus GN=Cpsf3 PE=1 SV=2 3 595 0.0E+00
sp|Q9C952|CPSF3_ARATH Cleavage and polyadenylation specificity factor subunit 3-I OS=Arabidopsis thaliana GN=CPSF73-I PE=1 SV=1 3 593 0.0E+00
sp|Q6C2Z7|YSH1_YARLI Endoribonuclease YSH1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YSH1 PE=3 SV=2 3 540 0.0E+00
sp|Q4IPN9|YSH1_GIBZE Endoribonuclease YSH1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=YSH1 PE=3 SV=2 7 717 0.0E+00
sp|Q5BEP0|YSH1_EMENI Endoribonuclease ysh1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ysh1 PE=3 SV=1 7 750 4.0E-180
sp|Q6BMW3|YSH1_DEBHA Endoribonuclease YSH1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=YSH1 PE=3 SV=2 12 474 1.0E-165
sp|Q5ZIH0|INT11_CHICK Integrator complex subunit 11 OS=Gallus gallus GN=CPSF3L PE=2 SV=1 7 513 9.0E-92
sp|Q9CWS4|INT11_MOUSE Integrator complex subunit 11 OS=Mus musculus GN=Cpsf3l PE=1 SV=1 7 458 5.0E-89
sp|Q3MHC2|INT11_RAT Integrator complex subunit 11 OS=Rattus norvegicus GN=Cpsf3l PE=2 SV=1 7 458 6.0E-89
sp|Q503E1|INT11_DANRE Integrator complex subunit 11 OS=Danio rerio GN=cpsf3l PE=2 SV=1 7 513 3.0E-87
sp|Q5TA45|INT11_HUMAN Integrator complex subunit 11 OS=Homo sapiens GN=CPSF3L PE=1 SV=2 7 458 1.0E-86
sp|Q5NVE6|INT11_PONAB Integrator complex subunit 11 OS=Pongo abelii GN=CPSF3L PE=2 SV=2 7 458 2.0E-86
sp|Q2YDM2|INT11_BOVIN Integrator complex subunit 11 OS=Bos taurus GN=CPSF3L PE=2 SV=2 7 497 4.0E-86
sp|Q54YL3|INT11_DICDI Integrator complex subunit 11 homolog OS=Dictyostelium discoideum GN=ints11 PE=3 SV=1 7 452 2.0E-81
sp|Q8GUU3|CPS3B_ARATH Cleavage and polyadenylation specificity factor subunit 3-II OS=Arabidopsis thaliana GN=CPSF73-II PE=1 SV=2 7 459 7.0E-80
sp|Q57626|Y162_METJA Uncharacterized protein MJ0162 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0162 PE=3 SV=1 13 423 1.0E-56
sp|Q58633|Y1236_METJA Uncharacterized protein MJ1236 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1236 PE=4 SV=1 7 459 8.0E-52
sp|Q5SLP1|RNSE_THET8 Ribonuclease TTHA0252 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=TTHA0252 PE=1 SV=1 7 423 7.0E-39
sp|Q60355|Y047_METJA Uncharacterized protein MJ0047 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0047 PE=3 SV=2 7 431 5.0E-33
sp|Q9LKF9|CPSF2_ARATH Cleavage and polyadenylation specificity factor subunit 2 OS=Arabidopsis thaliana GN=CPSF100 PE=1 SV=2 57 374 4.0E-32
sp|Q9W799|CPSF2_XENLA Cleavage and polyadenylation specificity factor subunit 2 OS=Xenopus laevis GN=cpsf2 PE=1 SV=1 4 376 2.0E-29
sp|Q10568|CPSF2_BOVIN Cleavage and polyadenylation specificity factor subunit 2 OS=Bos taurus GN=CPSF2 PE=1 SV=1 4 379 1.0E-28
sp|Q9P2I0|CPSF2_HUMAN Cleavage and polyadenylation specificity factor subunit 2 OS=Homo sapiens GN=CPSF2 PE=1 SV=2 4 379 2.0E-28
sp|Q652P4|CPSF2_ORYSJ Cleavage and polyadenylation specificity factor subunit 2 OS=Oryza sativa subsp. japonica GN=Os09g0569400 PE=2 SV=1 58 374 3.0E-28
sp|O35218|CPSF2_MOUSE Cleavage and polyadenylation specificity factor subunit 2 OS=Mus musculus GN=Cpsf2 PE=1 SV=1 4 379 7.0E-28
sp|Q9V3D6|CPSF2_DROME Probable cleavage and polyadenylation specificity factor subunit 2 OS=Drosophila melanogaster GN=Cpsf100 PE=1 SV=1 4 371 2.0E-27
sp|Q55BS1|CPSF2_DICDI Cleavage and polyadenylation specificity factor subunit 2 OS=Dictyostelium discoideum GN=cpsf2 PE=3 SV=1 4 358 5.0E-25
sp|O74740|CFT2_SCHPO Cleavage factor two protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cft2 PE=1 SV=1 60 357 4.0E-24
sp|A8XUS3|CPSF2_CAEBR Probable cleavage and polyadenylation specificity factor subunit 2 OS=Caenorhabditis briggsae GN=cpsf-2 PE=3 SV=2 4 359 1.0E-22
sp|O17403|CPSF2_CAEEL Probable cleavage and polyadenylation specificity factor subunit 2 OS=Caenorhabditis elegans GN=cpsf-2 PE=3 SV=1 4 359 3.0E-21
sp|Q6BMW3|YSH1_DEBHA Endoribonuclease YSH1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=YSH1 PE=3 SV=2 479 719 8.0E-19
sp|Q54SH0|INT9_DICDI Integrator complex subunit 9 homolog OS=Dictyostelium discoideum GN=ints9 PE=3 SV=1 31 419 2.0E-17
sp|Q55470|Y514_SYNY3 Uncharacterized protein sll0514 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0514 PE=4 SV=1 143 439 2.0E-15
sp|Q4R5Z4|INT9_MACFA Integrator complex subunit 9 OS=Macaca fascicularis GN=INTS9 PE=2 SV=1 22 418 4.0E-15
sp|Q8K114|INT9_MOUSE Integrator complex subunit 9 OS=Mus musculus GN=Ints9 PE=1 SV=1 47 418 9.0E-15
sp|Q9NV88|INT9_HUMAN Integrator complex subunit 9 OS=Homo sapiens GN=INTS9 PE=1 SV=2 47 418 1.0E-14
sp|Q2KJA6|INT9_BOVIN Integrator complex subunit 9 OS=Bos taurus GN=INTS9 PE=2 SV=1 47 418 4.0E-14
sp|Q5ZKK2|INT9_CHICK Integrator complex subunit 9 OS=Gallus gallus GN=INTS9 PE=2 SV=1 47 418 9.0E-14
sp|Q6DFF4|INT9_XENLA Integrator complex subunit 9 OS=Xenopus laevis GN=ints9 PE=2 SV=1 47 418 3.0E-13
sp|A7SBF0|INT9_NEMVE Integrator complex subunit 9 homolog OS=Nematostella vectensis GN=ints9 PE=3 SV=1 54 496 2.0E-12
sp|Q6C2Z7|YSH1_YARLI Endoribonuclease YSH1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YSH1 PE=3 SV=2 539 729 2.0E-11
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|577700
MADSAILSVTMLGAGQEVGRSCCVLQYRGKTLVCDTGVHPAYNGMASLPFIDDLDWSSVDAILITHFHLDHAAAL
TYITEKTNFKDGKGKVYMTHPTKALHKFMMQDFVRTSSASSDALFSPLDMQMSLASIIAVSAHQLITVCPGVSFI
PYHAGHVLGACMFLIDIAGLKILYTGDYSREEDRHLIKAELPPIRPDVLVVESTYGVHTGESREEKEHRFTSLVH
SIIRRGGHVLLPTFALGRAQELLLILDDYWKKHPDLHNVPVYYASGLARKCMAVYQTYIHTMNANIRSRFARRDN
PFVFKHISNVPQTRGWEKKIADGPPCVVLASPGFMQVGPSRELFEHWCPDARNGLIITGYSIEGTPARDIMTEPE
EFTTLKGATIPRRISVDEISFSAHVDYAQNSEFIEQVRAQHVVLVHGEATGMGRLRAAMQSRFKEKDEDVKIHTP
RNLETLNLSFRGERVAKAIGTLADSPPQTGDIVSGLLVAKDYSYTLLDPRDLRDFAGLTTCAVTQRQRIVLGVGW
DLVRWHLEGMFGNVEEGMDKDGVPTMRVMGVVDVKLTGEHELTLEWESSSSSDMIADSTLALIAGIDKSPASVKL
TSQPHAHEHLPLQKHKHPHADAEGELSSMTRVQRLAMFLEAHFGEVEFHQPDEEGNRSMDSEEGERSDDEEASLL
VRLDEADARIGLISLTVMSSNEALKRRVEAVLDMAVTTVSTLSEAFSSGVAVTGDDAGLTRESIVEEKGEEAKAK
EPEEMPTEEVPKEMDEDPKVTTEVVAVQSSEQ*
Coding >Agabi119p4|577700
ATGGCTGATTCGGCTATTCTGAGCGTGACGATGCTCGGCGCGGGTCAAGAGGTCGGGAGGTCATGTTGCGTATTG
CAGTATCGTGGAAAGACCCTCGTTTGCGATACGGGTGTGCACCCGGCTTATAATGGCATGGCTTCACTGCCGTTT
ATCGATGATTTGGACTGGAGTAGTGTGGATGCCATTCTTATTACTCACTTTCACTTGGATCATGCTGCCGCATTG
ACATATATCACTGAGAAAACGAATTTCAAGGATGGGAAAGGGAAGGTGTACATGACCCATCCAACAAAGGCCTTA
CACAAATTTATGATGCAGGATTTTGTACGGACAAGTTCAGCGTCTTCAGATGCACTTTTCTCGCCACTAGACATG
CAAATGTCATTAGCTTCCATCATTGCTGTCTCCGCCCACCAACTCATCACCGTCTGTCCCGGTGTTTCCTTCATC
CCTTACCACGCTGGGCACGTCCTCGGAGCATGCATGTTCCTCATCGATATCGCCGGACTAAAAATCCTCTACACA
GGGGACTATTCTCGGGAAGAGGACCGCCACCTCATAAAAGCCGAACTTCCACCTATCCGCCCAGATGTCCTCGTA
GTTGAAAGCACTTACGGTGTGCATACCGGTGAAAGTAGAGAAGAGAAGGAACATCGGTTTACGTCGTTGGTGCAT
TCGATCATTCGAAGAGGAGGACATGTTTTGTTGCCGACATTTGCTCTCGGGAGAGCACAGGAGTTGTTGTTGATC
CTAGATGACTATTGGAAGAAGCACCCGGACTTGCATAATGTACCGGTATATTATGCGTCGGGTTTGGCAAGAAAG
TGTATGGCGGTTTATCAAACTTACATTCACACAATGAACGCCAATATTCGGTCGAGATTCGCTCGAAGAGATAAT
CCTTTCGTTTTCAAGCACATTTCGAATGTACCGCAAACGAGGGGTTGGGAGAAAAAAATTGCGGATGGACCTCCG
TGTGTTGTGCTTGCAAGTCCTGGTTTCATGCAAGTCGGACCGAGTCGAGAACTTTTCGAGCATTGGTGCCCAGAC
GCCCGAAACGGTCTCATTATCACTGGTTATTCGATTGAAGGAACGCCGGCTAGGGATATCATGACGGAACCAGAA
GAGTTCACTACACTCAAAGGGGCAACAATACCGAGACGGATATCAGTAGACGAGATTTCCTTCAGCGCGCATGTG
GATTACGCTCAAAATTCAGAATTTATCGAACAAGTCAGAGCTCAACATGTGGTACTAGTACACGGTGAAGCGACT
GGTATGGGTCGATTAAGGGCAGCGATGCAGTCTAGGTTCAAGGAGAAAGACGAGGACGTCAAGATCCATACACCT
CGGAATTTGGAGACGTTGAATTTGTCATTTAGGGGTGAACGTGTTGCCAAGGCTATAGGTACCTTGGCGGACAGT
CCACCTCAAACAGGCGATATCGTCTCTGGACTATTAGTAGCCAAGGATTATTCGTATACGCTACTTGATCCTCGG
GATTTGCGAGATTTTGCGGGATTGACGACTTGTGCGGTAACGCAGAGGCAGAGGATAGTTTTAGGCGTGGGTTGG
GATTTGGTCAGATGGCATCTGGAAGGTATGTTTGGGAATGTGGAAGAGGGGATGGATAAAGATGGTGTTCCTACC
ATGAGGGTTATGGGAGTTGTTGATGTGAAATTGACCGGTGAACATGAGTTGACTTTGGAGTGGGAATCGAGTTCT
AGTAGTGACATGATCGCGGATTCAACGTTGGCTCTGATTGCTGGAATTGATAAGTCGCCGGCATCTGTGAAACTA
ACCTCACAACCGCACGCTCATGAGCATCTTCCTCTCCAAAAACATAAACATCCACATGCTGATGCTGAAGGAGAA
TTATCATCAATGACAAGGGTACAACGTTTAGCCATGTTTTTAGAAGCGCATTTTGGGGAGGTGGAATTTCATCAA
CCTGATGAAGAGGGGAATCGGAGTATGGATTCGGAAGAGGGGGAGAGGAGTGATGATGAAGAAGCGTCTTTGTTG
GTTAGACTTGATGAAGCTGATGCGAGAATTGGTTTGATATCTTTGACGGTCATGAGTTCGAATGAGGCGCTCAAG
AGACGTGTGGAAGCGGTTTTGGATATGGCAGTGACTACGGTTAGTACGTTGAGTGAGGCTTTTAGTTCTGGAGTT
GCTGTGACTGGTGATGATGCGGGATTGACGCGAGAGAGTATTGTGGAGGAGAAGGGGGAGGAGGCAAAGGCAAAG
GAGCCAGAAGAGATGCCGACAGAAGAGGTGCCGAAGGAAATGGATGAGGACCCCAAGGTAACCACGGAAGTTGTC
GCTGTACAAAGTTCAGAACAATGA
Transcript >Agabi119p4|577700
ATGGCTGATTCGGCTATTCTGAGCGTGACGATGCTCGGCGCGGGTCAAGAGGTCGGGAGGTCATGTTGCGTATTG
CAGTATCGTGGAAAGACCCTCGTTTGCGATACGGGTGTGCACCCGGCTTATAATGGCATGGCTTCACTGCCGTTT
ATCGATGATTTGGACTGGAGTAGTGTGGATGCCATTCTTATTACTCACTTTCACTTGGATCATGCTGCCGCATTG
ACATATATCACTGAGAAAACGAATTTCAAGGATGGGAAAGGGAAGGTGTACATGACCCATCCAACAAAGGCCTTA
CACAAATTTATGATGCAGGATTTTGTACGGACAAGTTCAGCGTCTTCAGATGCACTTTTCTCGCCACTAGACATG
CAAATGTCATTAGCTTCCATCATTGCTGTCTCCGCCCACCAACTCATCACCGTCTGTCCCGGTGTTTCCTTCATC
CCTTACCACGCTGGGCACGTCCTCGGAGCATGCATGTTCCTCATCGATATCGCCGGACTAAAAATCCTCTACACA
GGGGACTATTCTCGGGAAGAGGACCGCCACCTCATAAAAGCCGAACTTCCACCTATCCGCCCAGATGTCCTCGTA
GTTGAAAGCACTTACGGTGTGCATACCGGTGAAAGTAGAGAAGAGAAGGAACATCGGTTTACGTCGTTGGTGCAT
TCGATCATTCGAAGAGGAGGACATGTTTTGTTGCCGACATTTGCTCTCGGGAGAGCACAGGAGTTGTTGTTGATC
CTAGATGACTATTGGAAGAAGCACCCGGACTTGCATAATGTACCGGTATATTATGCGTCGGGTTTGGCAAGAAAG
TGTATGGCGGTTTATCAAACTTACATTCACACAATGAACGCCAATATTCGGTCGAGATTCGCTCGAAGAGATAAT
CCTTTCGTTTTCAAGCACATTTCGAATGTACCGCAAACGAGGGGTTGGGAGAAAAAAATTGCGGATGGACCTCCG
TGTGTTGTGCTTGCAAGTCCTGGTTTCATGCAAGTCGGACCGAGTCGAGAACTTTTCGAGCATTGGTGCCCAGAC
GCCCGAAACGGTCTCATTATCACTGGTTATTCGATTGAAGGAACGCCGGCTAGGGATATCATGACGGAACCAGAA
GAGTTCACTACACTCAAAGGGGCAACAATACCGAGACGGATATCAGTAGACGAGATTTCCTTCAGCGCGCATGTG
GATTACGCTCAAAATTCAGAATTTATCGAACAAGTCAGAGCTCAACATGTGGTACTAGTACACGGTGAAGCGACT
GGTATGGGTCGATTAAGGGCAGCGATGCAGTCTAGGTTCAAGGAGAAAGACGAGGACGTCAAGATCCATACACCT
CGGAATTTGGAGACGTTGAATTTGTCATTTAGGGGTGAACGTGTTGCCAAGGCTATAGGTACCTTGGCGGACAGT
CCACCTCAAACAGGCGATATCGTCTCTGGACTATTAGTAGCCAAGGATTATTCGTATACGCTACTTGATCCTCGG
GATTTGCGAGATTTTGCGGGATTGACGACTTGTGCGGTAACGCAGAGGCAGAGGATAGTTTTAGGCGTGGGTTGG
GATTTGGTCAGATGGCATCTGGAAGGTATGTTTGGGAATGTGGAAGAGGGGATGGATAAAGATGGTGTTCCTACC
ATGAGGGTTATGGGAGTTGTTGATGTGAAATTGACCGGTGAACATGAGTTGACTTTGGAGTGGGAATCGAGTTCT
AGTAGTGACATGATCGCGGATTCAACGTTGGCTCTGATTGCTGGAATTGATAAGTCGCCGGCATCTGTGAAACTA
ACCTCACAACCGCACGCTCATGAGCATCTTCCTCTCCAAAAACATAAACATCCACATGCTGATGCTGAAGGAGAA
TTATCATCAATGACAAGGGTACAACGTTTAGCCATGTTTTTAGAAGCGCATTTTGGGGAGGTGGAATTTCATCAA
CCTGATGAAGAGGGGAATCGGAGTATGGATTCGGAAGAGGGGGAGAGGAGTGATGATGAAGAAGCGTCTTTGTTG
GTTAGACTTGATGAAGCTGATGCGAGAATTGGTTTGATATCTTTGACGGTCATGAGTTCGAATGAGGCGCTCAAG
AGACGTGTGGAAGCGGTTTTGGATATGGCAGTGACTACGGTTAGTACGTTGAGTGAGGCTTTTAGTTCTGGAGTT
GCTGTGACTGGTGATGATGCGGGATTGACGCGAGAGAGTATTGTGGAGGAGAAGGGGGAGGAGGCAAAGGCAAAG
GAGCCAGAAGAGATGCCGACAGAAGAGGTGCCGAAGGAAATGGATGAGGACCCCAAGGTAACCACGGAAGTTGTC
GCTGTACAAAGTTCAGAACAATGA
Gene >Agabi119p4|577700
ATGGCTGATTCGGCTATTCTGAGCGTGACGATGCTCGGCGCGGGTCAAGAGGTCGGGAGGTCATGTTGCGTATTG
CAGTATCGTGGAAAGACCCTCGTTTGCGATACGGGTGTGCACCCGGCTTATAATGGCATGGCTTCACTGCCGTTT
ATCGATGATTTGGACTGGAGTAGTGTGGATGCCATTCTTATTACTCAGTGAGTTACTTTTCGTGAAGGATGTAGA
ACTGCAGTCATTGAAATTGTGCATGTTAGCTTTCACTTGGATCATGCTGCCGCATTGACATATATCACTGAGAAA
GTGCGTCGTTGACTCGTCATAATATTCTACTTTATACTCATAACAGTGTTTAGACGAATTTCAAGGATGGGAAAG
GGAAGGTGTACATGACCCATCCAACAAAGGCCTTACACAAATTTATGATGCAGGATTTTGTACGGACAAGGCGAG
CGAATTTCGTAAAATGCCCCCATAGGTTTACGCTCATGCTTGTTCTTCAGTTCAGCGTCTTCAGATGCACTTTTC
TCGCCACTAGACATGCAAATGTCATTAGCTTCCATCATTGCTGTCTCCGCCCACCAACTCATCACCGTCTGTCCC
GGTGTTTCCTTCATCCCTTACCACGCTGGGCACGTCCTCGGAGCATGCATGTTCCTCATCGATATCGCCGGACTA
AAAATCCTCTACACAGGGGACTATTCTCGGGAAGAGGACCGCCACCTCATAAAAGCCGAACTTCCACCTATCCGC
CCAGATGTCCTCGTAGTTGAAAGCACTTACGGTGTGCATACCGGTGAAAGTAGAGAAGAGAAGGAACATCGGTTT
ACGTCGTTGGTGCATTCGATCATTCGAAGAGGAGGACATGTTTTGTTGCCGACATTTGCTCTCGGGAGAGCACAG
GAGTTGTTGTTGATCCTAGATGACTATTGGAAGAAGCACCCGGACTTGCATAATGTACCGGTATATTATGCGTCG
GGTTTGGCAAGAAAGTGTATGGCGGTTTATCAAACTTACATTCACACAATGAACGCCAATATTCGGTCGAGATTC
GCTCGAAGAGATAATCCTTTCGTTTTCAAGTTTGTGATTCACTCTATATTTCACGGGATGGACCACTGATTTTTT
CTGGCGTTAGGCACATTTCGAATGTACCGCAAACGAGGGGTTGGGAGAAAAAAATTGCGGATGGACCTCCGTGTG
TTGTGCTTGCAAGTCCTGGTTTCATGCAAGTCGGACCGAGTCGAGAACTTTTCGAGCATTGGTGCCCAGACGCCC
GAAACGGTCTCATTATCACTGGTTATTCGATTGAAGGAACGCCGGCTAGGGTGAGTTTTGGTAGTTCAGGAAAAC
ATCCTTTCTTTCTCTTTGTATATACGTTATGCTTTGCGAATGGACACTATTTCAGTTTTCTTATCCACCTGTACT
GTTGTGAAACCACCTTTCTTCTTCGACAATTTGAGTTATGCGGAACGTTAAGCTTACTGTTATCTTTTCTCTAGG
ATATCATGACGGAACCAGAAGAGTTCACTACACTCAAAGGGGCAACAATACCGAGACGGATATCAGTAGACGAGA
TTTCCTTCAGCGCGCATGTGGATTACGCTCAAAATTCAGAATTTATCGAACAAGTCAGAGCTCAACATGTGGTAT
GTGATCTTTGGTGAATTGTCGATAATACCTAATCTATTAATAGGTACTAGTACACGGTGAAGCGACTGGTATGGG
TCGATTAAGGGCAGCGATGCAGTCTAGGTTCAAGGAGAAAGACGAGGACGTCAAGATCCATACACCTCGGAATTT
GGAGACGTTGAATTTGTCATTTAGGGGTGAACGTGTTGCCAAGGTTCGTTTTTATTTTTAATTATTCTGAACTTC
GAATCAGAGGTGCAAAAAGTTTATTTGAAAGTGTGCTTGTCTTCATATGTCTTTCTTCATAATTCTTCCTTCCGA
CTCGGGGGTGTTTTAACACCGAAAAAACAAACCTTTTTCGAAAAGTGCTGTTTGTTAATTTTTACGACGTTTATA
GGCTATAGGTACCTTGGCGGACAGTCCACCTCAAACAGGCGATATCGTCTCTGGACTATTAGTAGCCAAGGATTA
TTCGTATACGCTACTTGATCCTCGGGATTTGCGAGATTTTGCGGGATTGACGACTTGTGCGGTAACGCAGAGGCA
GAGGATAGTTTTAGGCGTGGGTTGGGATTTGGTCAGATGGCATCTGGAAGGTATGTTTGGGAATGTGGAAGAGGG
GATGGATAAAGATGGTGTTCCTACCATGAGGGTACGTTTGATGATTCCGTGCTTCTCGTCGATATGTTCCCGTCT
TTTTGTCTGATGCGTTTATTTGTTATTATAGGTTATGGGAGTTGTTGATGTGAAATTGACCGGTGAACATGAGTT
GACTTTGGAGTGGGAATCGAGTTCTAGTAGTGACATGATCGCGGATTCAACGTTGGCTCTGATTGCTGGAATTGA
TAAGTCGCCGGCATCTGTGAAACGTGCGTGTTTTATTTTTTTTCTGTTTGGAGGTATCAATTTGTGTTGATTTAT
ACAATGGTTCAACCACGTCAAAAAACAAAAATCTTCAAATGCTGCTCGGACATCTCTATCTACCGCGTTATAATC
TCAATCAATCTAGTAACCTCACAACCGCACGCTCATGAGCATCTTCCTCTCCAAAAACATAAACATCCACATGCT
GATGCTGAAGGAGAATTATCATCAATGACAAGGGTACAACGTTTAGCCATGTTTTTAGAAGCGCATTTTGGGGAG
GTGGAATTTCATCAACCTGATGAAGAGGGGAATCGGAGTATGGATTCGGAAGAGGGGGAGAGGAGTGATGATGAA
GAAGCGTCTTTGTTGGTTAGACTTGATGAAGCTGATGCGAGAATTGGTTTGATATCTTTGGTGCGTGATTACTCT
TTTTGTTAAGTTTGACAATACTCATCAGGGTTCTGATTGTTTTGTTCTTCGTTTATCCAATTTTGGACTTGTTTG
TTCTTTCGGTGTTTTTTTTTTTCCTTGTTCGTTTCCGGTTCCCCTCCTTGTTTCTTTCTCTTTGATGGATCGTCG
TCATCGTGGTACGTATTATTATTGTTATTGTTTTTTTCGGTGCTTTTTCATGGCACTTTTTGATACATTATTTCT
TTTCTATTGTTTTGATTGCAACATGACATCAACTGGGCGGTGTTTGATTGTTGGGATCCTTTCTATTGTTGGTTG
GTTTTATTTGCTTCTTTTTCATCAGACGGTCATGAGTTCGAATGAGGCGCTCAAGAGACGTGTGGAAGCGGTTTT
GGATATGGCAGTGACTACGGTTAGTACGTTGAGTGAGGCTTTTAGTTCTGGAGTTGCTGTGACTGGTGATGATGC
GGGATTGACGCGAGAGAGTATTGTGGAGGAGAAGGGGGAGGAGGCAAAGGCAAAGGAGCCAGAAGAGATGCCGAC
AGAAGAGGTGCCGAAGGAAATGGATGAGGACCCCAAGGTAACCACGGAAGTTGTCGCTGTACAAAGTTCAGAACA
ATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail