Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|576350
Gene name
Locationscaffold_02:308823..310572
Strand-
Gene length (bp)1749
Transcript length (bp)1485
Coding sequence length (bp)1485
Protein length (aa) 495

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13641 Glyco_tranf_2_3 Glycosyltransferase like family 2 1.7E-32 52 285
PF00535 Glycos_transf_2 Glycosyl transferase family 2 7.4E-08 55 179
PF13506 Glyco_transf_21 Glycosyl transferase family 21 5.1E-06 114 284

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O00219|HYAS3_HUMAN Hyaluronan synthase 3 OS=Homo sapiens GN=HAS3 PE=2 SV=3 85 409 4.0E-10
sp|O08650|HYAS3_MOUSE Hyaluronan synthase 3 OS=Mus musculus GN=Has3 PE=1 SV=2 127 409 1.0E-09
sp|P04341|NODC_RHIME N-acetylglucosaminyltransferase OS=Rhizobium meliloti (strain 1021) GN=nodC PE=3 SV=1 101 410 4.0E-08
sp|Q07755|NODC_AZOC5 N-acetylglucosaminyltransferase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=nodC PE=3 SV=2 115 410 5.0E-07

GO

GO Term Description Terminal node
GO:0016757 glycosyltransferase activity Yes
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.5

Transmembrane Domains

Domain # Start End Length
1 10 27 17
2 315 337 22
3 378 400 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|576350
MLYLTADSFPVFVPFGIIGFYRYLWFLIRVAAWWTYRPVPIPENPTYVASEDVTIIVPTIDAGEEFKEAAHSWLV
GKPKEILIITEEKMLGPLQDLANQVDPERIRVLTVPFANKRLQMSHGIKNCTTDIIVFADDDAIWPPTLLPYVLA
CFEDQQVGGVGTSQRVQSVGNRMTVWEVLAAFRLTIRNIEISSSTHIDGGIPCLSGRTAAYRTVILKDPEFLHGF
THDFWLGKYQLNSGDDKFLTRWMVSHGWNTQVQVCKEAELLSTMKPNWRFLKQVLRWTRNTWRSDLRSLFMERYI
WTQHPYVAYTMCDKLINPFTLLVGPCLVSYLVYKSTIPVDAGGYHLPWWNIVLSYVVWLSATRTAKLLPHLWNRP
QDIIYVPAFILFGYYFAIMKLYALCTLHETGWGTRAGIGDIGAATAAIDAGNEKTANNPYSQPAGAFSNSQNPLS
PFRDQVPLSPYRDTPGSTLSYSNRGNANRRTDEEGVELQVGYAR*
Coding >Agabi119p4|576350
ATGCTCTACCTCACCGCCGACTCTTTCCCAGTTTTCGTCCCCTTTGGAATTATCGGTTTTTACCGCTACTTATGG
TTCCTAATACGCGTGGCAGCGTGGTGGACATACCGCCCCGTCCCTATTCCAGAAAATCCCACCTACGTCGCCTCT
GAAGATGTCACTATCATCGTTCCCACTATTGATGCCGGCGAGGAATTCAAGGAAGCCGCCCATAGCTGGCTCGTC
GGCAAGCCCAAAGAAATCCTCATCATCACTGAAGAAAAAATGCTAGGACCCCTTCAAGACCTTGCTAACCAAGTC
GATCCTGAGCGCATACGTGTCCTCACCGTTCCCTTTGCCAACAAACGCCTCCAAATGAGCCACGGCATCAAGAAC
TGCACCACTGACATCATTGTATTTGCTGACGATGATGCCATCTGGCCGCCTACACTTCTTCCCTATGTCCTTGCC
TGTTTCGAAGACCAACAAGTCGGTGGTGTCGGAACAAGTCAACGAGTACAGTCCGTTGGTAATAGGATGACCGTT
TGGGAGGTATTAGCCGCTTTCCGGCTTACCATTCGAAATATCGAAATATCTTCCTCCACACACATAGATGGCGGT
ATACCCTGTTTATCAGGACGGACAGCCGCATACCGCACTGTTATTCTCAAAGACCCCGAGTTTCTCCATGGCTTC
ACTCACGACTTTTGGCTCGGGAAATACCAACTTAATTCGGGTGACGACAAATTTTTGACGCGATGGATGGTTAGC
CACGGATGGAACACCCAGGTTCAGGTCTGCAAGGAAGCCGAGCTTTTGAGTACCATGAAGCCCAACTGGCGCTTC
TTGAAGCAGGTGCTACGTTGGACTCGAAATACCTGGCGGTCGGATTTGAGGAGTTTGTTCATGGAACGCTACATC
TGGACACAGCATCCTTACGTCGCATACACCATGTGCGACAAACTCATTAACCCTTTTACCTTGCTTGTCGGACCC
TGTTTGGTCTCATACCTTGTTTACAAGAGTACAATCCCTGTCGATGCGGGTGGATATCACTTGCCTTGGTGGAAT
ATCGTCCTGTCATACGTCGTTTGGCTTAGTGCGACTCGTACAGCCAAGCTCCTCCCACATCTCTGGAATCGTCCT
CAAGACATCATTTATGTGCCCGCATTCATTCTGTTTGGGTACTATTTCGCTATCATGAAACTGTATGCCCTTTGC
ACGCTACACGAAACTGGATGGGGAACACGTGCTGGTATCGGTGACATTGGCGCTGCCACCGCTGCTATTGATGCG
GGTAACGAGAAGACGGCTAATAATCCATACTCGCAACCGGCCGGCGCTTTTAGCAATTCTCAAAACCCATTATCC
CCGTTCCGTGACCAAGTACCTCTATCACCATACCGTGATACACCGGGCTCAACGCTATCCTATTCGAACCGAGGT
AATGCAAATCGAAGAACAGATGAAGAAGGTGTCGAGTTACAGGTGGGCTATGCTCGCTGA
Transcript >Agabi119p4|576350
ATGCTCTACCTCACCGCCGACTCTTTCCCAGTTTTCGTCCCCTTTGGAATTATCGGTTTTTACCGCTACTTATGG
TTCCTAATACGCGTGGCAGCGTGGTGGACATACCGCCCCGTCCCTATTCCAGAAAATCCCACCTACGTCGCCTCT
GAAGATGTCACTATCATCGTTCCCACTATTGATGCCGGCGAGGAATTCAAGGAAGCCGCCCATAGCTGGCTCGTC
GGCAAGCCCAAAGAAATCCTCATCATCACTGAAGAAAAAATGCTAGGACCCCTTCAAGACCTTGCTAACCAAGTC
GATCCTGAGCGCATACGTGTCCTCACCGTTCCCTTTGCCAACAAACGCCTCCAAATGAGCCACGGCATCAAGAAC
TGCACCACTGACATCATTGTATTTGCTGACGATGATGCCATCTGGCCGCCTACACTTCTTCCCTATGTCCTTGCC
TGTTTCGAAGACCAACAAGTCGGTGGTGTCGGAACAAGTCAACGAGTACAGTCCGTTGGTAATAGGATGACCGTT
TGGGAGGTATTAGCCGCTTTCCGGCTTACCATTCGAAATATCGAAATATCTTCCTCCACACACATAGATGGCGGT
ATACCCTGTTTATCAGGACGGACAGCCGCATACCGCACTGTTATTCTCAAAGACCCCGAGTTTCTCCATGGCTTC
ACTCACGACTTTTGGCTCGGGAAATACCAACTTAATTCGGGTGACGACAAATTTTTGACGCGATGGATGGTTAGC
CACGGATGGAACACCCAGGTTCAGGTCTGCAAGGAAGCCGAGCTTTTGAGTACCATGAAGCCCAACTGGCGCTTC
TTGAAGCAGGTGCTACGTTGGACTCGAAATACCTGGCGGTCGGATTTGAGGAGTTTGTTCATGGAACGCTACATC
TGGACACAGCATCCTTACGTCGCATACACCATGTGCGACAAACTCATTAACCCTTTTACCTTGCTTGTCGGACCC
TGTTTGGTCTCATACCTTGTTTACAAGAGTACAATCCCTGTCGATGCGGGTGGATATCACTTGCCTTGGTGGAAT
ATCGTCCTGTCATACGTCGTTTGGCTTAGTGCGACTCGTACAGCCAAGCTCCTCCCACATCTCTGGAATCGTCCT
CAAGACATCATTTATGTGCCCGCATTCATTCTGTTTGGGTACTATTTCGCTATCATGAAACTGTATGCCCTTTGC
ACGCTACACGAAACTGGATGGGGAACACGTGCTGGTATCGGTGACATTGGCGCTGCCACCGCTGCTATTGATGCG
GGTAACGAGAAGACGGCTAATAATCCATACTCGCAACCGGCCGGCGCTTTTAGCAATTCTCAAAACCCATTATCC
CCGTTCCGTGACCAAGTACCTCTATCACCATACCGTGATACACCGGGCTCAACGCTATCCTATTCGAACCGAGGT
AATGCAAATCGAAGAACAGATGAAGAAGGTGTCGAGTTACAGGTGGGCTATGCTCGCTGA
Gene >Agabi119p4|576350
ATGCTCTACCTCACCGCCGACTCTTTCCCAGTTTGTGAGTTGCTGTCTTCTTTCTCCCACTCGTCCCCCGAGTCT
TACTTCGACCCCTAGTCGTCCCCTTTGGAATTATCGGGTAGCTTTCTTCGCCTCAATTCCCGCCTTCTTACCAAC
TGACTCGCATCCAGTTTTTACCGCTACTTATGGTTCCTAATACGCGTGGCAGCGTGGTGGACATACCGCCCCGTC
CCTATTCCAGAAAATCCCACCTACGTCGCCTCTGAAGATGTCACTATCATCGTTCCCACTATTGATGCCGGCGAG
GAATTCAAGGAAGCCGCCCATAGCTGGCTCGTCGGCAAGCCCAAAGAAATCCTCATCATCACTGAAGAAAAAATG
CTAGGACCCCTTCAAGACCTTGCTAACCAAGTCGATCCTGAGCGCATACGTGTCCTCACCGTTCCCTTTGCCAAC
AAACGCCTCCAAATGAGCCACGGCATCAAGAACTGCACCACTGACATCATTGTATTTGCTGACGATGATGCCATC
TGGCCGCCTACACTTCTTCCCTATGTCCTTGCCTGTTTCGAAGACCAACAAGTCGGTGGTGTCGGAACAAGTCAA
CGAGTACAGTCCGTTGGTAATAGGATGACCGTTTGGGAGGTATTAGCCGCTTTCCGGCTTACCATTCGAAATATC
GAAATATCTTCCTCCACACACATAGATGGCGGTATACCCTGTTTATCAGGACGGACAGCCGCATACCGCACTGTT
ATTCTCAAAGACCCCGAGTTTCTCCATGGCTTCACTCACGACTTTTGGCTCGGGAAATACCAACTTAATTCGGGT
GACGACAAATTTTTGACGCGATGGATGGTTAGCCACGGATGGAACACCCAGGTTCAGGTCTGCAAGGAAGCCGAG
CTTTTGAGTACCATGAAGCCCAACTGGCGCTTCTTGAAGCAGGTGCTACGTTGGACTCGAAATACCTGGCGGTCG
GATTTGAGGAGTTTGTTCATGGAACGCTACATCTGGACACAGCATCCTTACGTCGCATACACCATGGTTCGTACT
TGGCCTTCATTTGTACTTCTCAAGTTGATTGACTTCCTATGTCAGTGCGACAAACTCATTAACCCTTTTACCTTG
CTTGTCGGACCCTGTTTGGTCTCATACCTTGTTTACAAGAGTACAATCCCTGTCGATGCGGGTGGATATCACTTG
CCTTGGTGGTAAGTAGCCTTAGAATCATTTGATTTTAGGTTGTTCATGCTTCTCCTAGGAATATCGTCCTGTCAT
ACGTCGTTTGGCTTAGTGCGACTCGTACAGCCAAGCTCCTCCCACATCTCTGGAATCGTCCTCAAGACATCATTT
ATGTGCCCGCATTCATTCTGTTTGGGTACTATTTCGCTATCATGAAACTGTATGCCCTTTGCACGCTACACGAAG
TGGGTCTTTTTGTTTTTCCCGATGTGAAAATATCTTAATCTCGTTATACAGACTGGATGGGGAACACGTGCTGGT
ATCGGTGACATTGGCGCTGCCACCGCTGCTATTGATGCGGGTAACGAGAAGACGGCTAATAATCCATACTCGCAA
CCGGCCGGCGCTTTTAGCAATTCTCAAAACCCATTATCCCCGTTCCGTGACCAAGTACCTCTATCACCATACCGT
GATACACCGGGCTCAACGCTATCCTATTCGAACCGAGGTAATGCAAATCGAAGAACAGATGAAGAAGGTGTCGAG
TTACAGGTGGGCTATGCTCGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail