Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|571800
Gene name
Locationscaffold_01b:57165..57903
Strand-
Gene length (bp)738
Transcript length (bp)678
Coding sequence length (bp)678
Protein length (aa) 226

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11 4.2E-71 48 223

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B8NKE9|XYNA_ASPFN Probable endo-1,4-beta-xylanase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=xlnA PE=3 SV=2 1 224 2.0E-81
sp|Q9HFA4|XYNA_ASPOR Endo-1,4-beta-xylanase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=xlnA PE=1 SV=1 1 224 2.0E-81
sp|P55332|XYNA_EMENI Endo-1,4-beta-xylanase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=xlnA PE=1 SV=1 1 224 4.0E-80
sp|Q4WG11|XYNA_ASPFU Endo-1,4-beta-xylanase xynf11a OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=xlnA PE=1 SV=1 1 224 1.0E-78
sp|B0XXF3|XYNA_ASPFC Probable endo-1,4-beta-xylanase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=xlnA PE=3 SV=1 1 224 1.0E-78
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B8NKE9|XYNA_ASPFN Probable endo-1,4-beta-xylanase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=xlnA PE=3 SV=2 1 224 2.0E-81
sp|Q9HFA4|XYNA_ASPOR Endo-1,4-beta-xylanase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=xlnA PE=1 SV=1 1 224 2.0E-81
sp|P55332|XYNA_EMENI Endo-1,4-beta-xylanase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=xlnA PE=1 SV=1 1 224 4.0E-80
sp|Q4WG11|XYNA_ASPFU Endo-1,4-beta-xylanase xynf11a OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=xlnA PE=1 SV=1 1 224 1.0E-78
sp|B0XXF3|XYNA_ASPFC Probable endo-1,4-beta-xylanase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=xlnA PE=3 SV=1 1 224 1.0E-78
sp|A1DJ52|XYNA_NEOFI Probable endo-1,4-beta-xylanase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=xlnA PE=3 SV=1 1 224 3.0E-78
sp|Q0CFS3|XYNA_ASPTN Probable endo-1,4-beta-xylanase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=xlnA PE=3 SV=1 4 224 7.0E-76
sp|Q0ZHI9|XYNG_VERDA Endo-1,4-beta-xylanase G OS=Verticillium dahliae GN=xynG PE=1 SV=1 1 224 2.0E-75
sp|Q9HGE1|XYN2_HUMGT Endo-1,4-beta-xylanase 2 OS=Humicola grisea var. thermoidea GN=xyn2 PE=1 SV=1 1 224 2.0E-73
sp|P55334|XYN1_HUMIN Endo-1,4-beta-xylanase 1 OS=Humicola insolens GN=XYL1 PE=2 SV=1 1 224 3.0E-73
sp|A1DNU5|XYNB_NEOFI Probable endo-1,4-beta-xylanase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=xlnB PE=3 SV=1 1 224 1.0E-72
sp|P55333|XYNB_EMENI Endo-1,4-beta-xylanase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=xlnB PE=2 SV=2 1 225 2.0E-72
sp|A1CU59|XYNB_ASPCL Probable endo-1,4-beta-xylanase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=xlnB PE=3 SV=2 1 224 1.0E-71
sp|P36217|XYN2_HYPJE Endo-1,4-beta-xylanase 2 OS=Hypocrea jecorina GN=xyn2 PE=1 SV=1 4 224 6.0E-71
sp|A1CCU0|XYNA_ASPCL Probable endo-1,4-beta-xylanase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=xlnA PE=3 SV=1 25 224 7.0E-71
sp|Q9HFH0|XYNC_TALFU Endo-1,4-beta-xylanase C OS=Talaromyces funiculosus GN=xynC PE=1 SV=1 8 224 1.0E-70
sp|P48824|XYNB_ASPKW Endo-1,4-beta-xylanase B OS=Aspergillus kawachii (strain NBRC 4308) GN=xlnB PE=3 SV=2 5 224 1.0E-70
sp|P87037|XYNB_ASPOR Probable endo-1,4-beta-xylanase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=xlnB PE=1 SV=1 1 224 1.0E-69
sp|B8NJ86|XYNB_ASPFN Probable endo-1,4-beta-xylanase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=xlnB PE=3 SV=1 1 224 1.0E-69
sp|I1S2K3|XYNA_GIBZE Endo-1,4-beta-xylanase A OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=XYLA PE=1 SV=1 1 224 5.0E-69
sp|Q4WLV2|XYNB_ASPFU Probable endo-1,4-beta-xylanase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=xlnB PE=3 SV=1 1 224 4.0E-68
sp|B0Y8Q8|XYNB_ASPFC Probable endo-1,4-beta-xylanase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=xlnB PE=3 SV=1 1 224 4.0E-68
sp|B7SIW1|XYNB_PHACH Endo-1,4-beta-xylanase B OS=Phanerochaete chrysosporium GN=xynB PE=1 SV=1 1 225 7.0E-67
sp|B5A7N4|XYN2_TRIHA Endo-1,4-beta-xylanase 2 OS=Trichoderma harzianum GN=Xyn2 PE=1 SV=1 1 224 7.0E-66
sp|Q2LMP0|XY11A_BOTFU Endo-1,4-beta-xylanase 11A OS=Botryotinia fuckeliana GN=xyn11A PE=2 SV=1 18 225 1.0E-65
sp|P55330|XYNB_ASPNG Endo-1,4-beta-xylanase B OS=Aspergillus niger GN=xlnB PE=1 SV=1 30 224 5.0E-65
sp|A2Q7I0|XYNB_ASPNC Probable endo-1,4-beta-xylanase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=xlnB PE=3 SV=1 30 224 5.0E-65
sp|G4NA54|XYN4_MAGO7 Endo-1,4-beta-xylanase 4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=XYL4 PE=3 SV=1 40 224 9.0E-65
sp|Q92245|XYN4_MAGGR Endo-1,4-beta-xylanase 4 OS=Magnaporthe grisea GN=XYL4 PE=3 SV=2 40 224 9.0E-65
sp|A6YAP7|XYN1_LEUGO Endo-1,4-beta-xylanase 1 OS=Leucoagaricus gongylophorus GN=Xyn1 PE=1 SV=1 4 224 1.0E-64
sp|I1RII8|XYNB_GIBZE Endo-1,4-beta-xylanase B OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=XYLB PE=1 SV=1 1 224 5.0E-64
sp|Q06562|XYN1_COCCA Endo-1,4-beta-xylanase I OS=Cochliobolus carbonum GN=XYL1 PE=1 SV=1 32 225 4.0E-63
sp|B3VSG7|XY11A_BOTFB Endo-1,4-beta-xylanase 11A OS=Botryotinia fuckeliana (strain B05.10) GN=xyn11A PE=1 SV=1 18 225 1.0E-62
sp|E7EF85|XYNB_PENOX Endo-1,4-beta-xylanase B OS=Penicillium oxalicum GN=xynB PE=1 SV=1 1 224 3.0E-62
sp|Q2PGY1|XYNA_PENCI Endo-1,4-beta-xylanase A OS=Penicillium citrinum GN=xynA PE=1 SV=1 1 224 3.0E-62
sp|P48793|XYN_TRIHA Endo-1,4-beta-xylanase OS=Trichoderma harzianum PE=1 SV=1 36 224 9.0E-62
sp|P0CT49|XYN1_MAGO7 Endo-1,4-beta-xylanase 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=XYL1 PE=3 SV=1 1 224 6.0E-61
sp|P0CT48|XYN1_MAGGR Endo-1,4-beta-xylanase 1 OS=Magnaporthe grisea GN=XYL1 PE=1 SV=1 1 224 6.0E-61
sp|D7EZJ3|XYNB_STRSQ Endo-1,4-beta-xylanase B OS=Streptomyces sp. GN=xynBS9 PE=1 SV=1 36 224 6.0E-59
sp|P26515|XYNB_STRLI Endo-1,4-beta-xylanase B OS=Streptomyces lividans GN=xlnB PE=1 SV=3 38 224 3.0E-58
sp|W0HJ53|XYN2_RHIOR Endo-1,4-beta-xylanase 2 OS=Rhizopus oryzae GN=xyn2 PE=1 SV=1 33 224 1.0E-57
sp|O74716|XYN1_CLAPU Endo-1,4-beta-xylanase 1 OS=Claviceps purpurea GN=xyl1 PE=2 SV=1 4 225 7.0E-57
sp|P35809|XYNA_SCHCO Endo-1,4-beta-xylanase A OS=Schizophyllum commune GN=XYNA PE=1 SV=1 40 224 2.0E-56
sp|O43097|XYNA_THELA Endo-1,4-beta-xylanase OS=Thermomyces lanuginosus GN=XYNA PE=1 SV=1 32 224 2.0E-56
sp|G4MWS3|XYN3_MAGO7 Endo-1,4-beta-xylanase 3 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=XYL3 PE=3 SV=1 15 224 2.0E-55
sp|Q92244|XYN3_MAGGR Endo-1,4-beta-xylanase 3 OS=Magnaporthe grisea GN=XYL3 PE=1 SV=2 15 224 2.0E-55
sp|P54865|XYND_CELFI Bifunctional xylanase/deacetylase OS=Cellulomonas fimi GN=xynD PE=1 SV=1 38 224 3.0E-53
sp|Q8VP72|XY11B_CELJA Endo-1,4-beta-xylanase Xyn11B OS=Cellvibrio japonicus GN=xyn11B PE=1 SV=1 33 224 5.0E-53
sp|Q59674|XY11A_CELJA Bifunctional xylanase/xylan deacetylase OS=Cellvibrio japonicus GN=xyn11A PE=1 SV=1 31 224 2.0E-51
sp|O97402|XYN_PHACE Endo-1,4-beta-xylanase OS=Phaedon cochleariae PE=2 SV=1 31 224 1.0E-50
sp|P81536|XYNA_BYSSP Endo-1,4-beta-xylanase OS=Byssochlamys spectabilis PE=1 SV=1 40 224 2.0E-50
sp|Q9RI72|XYNC_STRCO Endo-1,4-beta-xylanase C OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=xlnC PE=3 SV=1 4 224 4.0E-50
sp|P26220|XYNC_STRLI Endo-1,4-beta-xylanase C OS=Streptomyces lividans GN=xlnC PE=1 SV=1 4 224 3.0E-47
sp|P45705|XYNA_GEOSE Endo-1,4-beta-xylanase A OS=Geobacillus stearothermophilus GN=xynA PE=3 SV=2 63 224 2.0E-44
sp|Q12562|XYNA_AURPU Endo-1,4-beta-xylanase A OS=Aureobasidium pullulans GN=xynA PE=1 SV=1 62 224 4.0E-44
sp|Q96TR7|XYN1_AURPU Endo-1,4-beta-xylanase 1 OS=Aureobasidium pullulans GN=xynI PE=1 SV=1 62 225 3.0E-43
sp|P36218|XYN1_HYPJE Endo-1,4-beta-xylanase 1 OS=Hypocrea jecorina GN=xyn1 PE=1 SV=1 1 224 3.0E-43
sp|P18429|XYNA_BACSU Endo-1,4-beta-xylanase A OS=Bacillus subtilis (strain 168) GN=xynA PE=1 SV=1 63 224 4.0E-42
sp|P09850|XYNA_BACCI Endo-1,4-beta-xylanase OS=Bacillus circulans GN=xlnA PE=1 SV=1 63 224 6.0E-42
sp|P55329|XYNA_ASPNG Endo-1,4-beta-xylanase A OS=Aspergillus niger GN=xynA PE=1 SV=1 62 225 9.0E-42
sp|Q6QJ75|XYN6_ASPNG Endo-1,4-beta-xylanase 6 OS=Aspergillus niger GN=XYN6 PE=1 SV=1 62 225 2.0E-41
sp|P55331|XYNA_ASPTU Endo-1,4-beta-xylanase A OS=Aspergillus tubingensis GN=xynA PE=3 SV=2 62 225 2.0E-41
sp|P55328|XYNA_ASPAW Endo-1,4-beta-xylanase A OS=Aspergillus awamori GN=xynA PE=1 SV=1 62 225 5.0E-41
sp|P33557|XYN3_ASPKW Endo-1,4-beta-xylanase 3 OS=Aspergillus kawachii (strain NBRC 4308) GN=xynC PE=1 SV=2 62 225 5.0E-41
sp|P00694|XYNA_BACPU Endo-1,4-beta-xylanase A OS=Bacillus pumilus GN=xynA PE=1 SV=2 36 225 4.0E-39
sp|Q8J0K5|XYNB_TALFU Endo-1,4-beta-xylanase B OS=Talaromyces funiculosus GN=xynB PE=1 SV=1 64 224 1.0E-38
sp|Q8GJ44|XYNA1_CLOSR Endo-1,4-beta-xylanase A OS=Clostridium stercorarium GN=xynA PE=1 SV=2 94 225 3.0E-37
sp|P17137|XYNA_CLOSA Endo-1,4-beta-xylanase OS=Clostridium saccharobutylicum GN=xynB PE=3 SV=1 36 222 5.0E-37
sp|Q12550|XYN4_ASPNG Endo-1,4-beta-xylanase 4 OS=Aspergillus niger GN=XYN4 PE=1 SV=2 62 225 2.0E-36
sp|P83513|XY11A_PSEXY Bifunctional xylanase/deacetylase OS=Pseudobutyrivibrio xylanivorans GN=xyn11A PE=1 SV=2 31 225 1.0E-35
sp|Q96W72|XYNB_TALPU Endo-1,4-beta-xylanase B OS=Talaromyces purpurogenus GN=xynB PE=1 SV=1 69 224 2.0E-35
sp|A2R4D1|XYN5_ASPNC Probable endo-1,4-beta-xylanase 5 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=XYN5 PE=3 SV=1 4 224 3.0E-35
sp|P33558|XYNA2_CLOSR Endo-1,4-beta-xylanase A OS=Clostridium stercorarium GN=xynA PE=1 SV=2 94 225 3.0E-34
sp|Q12549|XYN5_ASPNG Endo-1,4-beta-xylanase 5 OS=Aspergillus niger GN=XYN5 PE=1 SV=1 4 225 6.0E-34
sp|Q4P0L3|XY11A_USTMA Endo-1,4-beta-xylanase 11A OS=Ustilago maydis (strain 521 / FGSC 9021) GN=XYN11A PE=1 SV=1 27 224 7.0E-34
sp|P29126|XYNA_RUMFL Bifunctional endo-1,4-beta-xylanase XylA OS=Ruminococcus flavefaciens GN=xynA PE=3 SV=1 42 222 3.0E-32
sp|Q53317|XYND_RUMFL Xylanase/beta-glucanase OS=Ruminococcus flavefaciens GN=xynD PE=3 SV=2 10 222 4.0E-28
sp|P35811|XYNC_FIBSS Endo-1,4-beta-xylanase C OS=Fibrobacter succinogenes (strain ATCC 19169 / S85) GN=xynC PE=1 SV=2 108 223 7.0E-21
sp|P29127|XYNA_NEOPA Bifunctional endo-1,4-beta-xylanase A OS=Neocallimastix patriciarum GN=XYNA PE=1 SV=1 4 223 2.0E-17
sp|A8TGA1|XYS20_NEOPA Endo-1,4-beta-xylanase S20 OS=Neocallimastix patriciarum GN=xynS20 PE=1 SV=1 28 213 2.0E-17
sp|P29127|XYNA_NEOPA Bifunctional endo-1,4-beta-xylanase A OS=Neocallimastix patriciarum GN=XYNA PE=1 SV=1 44 224 6.0E-17
sp|Q12667|XYNA_PIRSP Endo-1,4-beta-xylanase A OS=Piromyces sp. GN=XYNA PE=2 SV=1 108 212 5.0E-16
sp|Q9UV68|XYNC_NEOPA Endo-1,4-beta-xylanase C OS=Neocallimastix patriciarum GN=xynC PE=1 SV=1 108 225 9.0E-15
sp|B8YG19|XS20E_NEOPA Bifunctional acetylxylan esterase/xylanase XynS20E OS=Neocallimastix patriciarum GN=xynS20E PE=1 SV=1 108 220 7.0E-14
sp|P35811|XYNC_FIBSS Endo-1,4-beta-xylanase C OS=Fibrobacter succinogenes (strain ATCC 19169 / S85) GN=xynC PE=1 SV=2 4 203 9.0E-13
sp|Q12667|XYNA_PIRSP Endo-1,4-beta-xylanase A OS=Piromyces sp. GN=XYNA PE=2 SV=1 108 225 1.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|571800
MVSMKSFLFLASAALTAMAMPHFANNTESHLLVPRQTINTPSTGFVDGHFYSLWMQSSTGATMNVQGNSYSLNWQ
TSSQNVVGGIGWNPGSSRVINYSGNFNCAANCYLSIYGWTENPLIEYYIVESYGTFNPGSQAQLLGSVNSDGGTY
NIYHTVRVNQPSIHGTATFDQFWSVRTSHRVGGSVNVGNHFAAWASHGLRLGSHNYQIVASEGFQSSGSSSITVN
*
Coding >Agabi119p4|571800
ATGGTCTCTATGAAGTCTTTCCTCTTTCTCGCCTCAGCGGCTCTCACCGCTATGGCCATGCCACATTTCGCCAAC
AACACCGAATCTCACCTACTCGTCCCTCGCCAGACTATCAATACTCCTTCCACTGGTTTTGTTGACGGCCACTTC
TACTCCTTGTGGATGCAATCCAGCACCGGTGCCACAATGAATGTTCAGGGCAACTCGTACAGTTTGAACTGGCAA
ACGTCTAGCCAAAACGTTGTCGGTGGAATTGGCTGGAACCCAGGAAGTAGCAGGGTGATCAACTACAGTGGTAAC
TTCAACTGTGCCGCAAACTGCTACCTGTCCATCTACGGGTGGACTGAAAACCCACTCATCGAGTACTACATCGTC
GAATCCTACGGTACCTTTAACCCTGGTAGCCAAGCTCAACTCTTGGGTTCTGTCAATTCTGACGGTGGAACCTAC
AACATCTACCACACCGTCCGCGTGAACCAACCTTCGATCCACGGAACTGCGACGTTCGACCAGTTCTGGTCCGTC
CGCACGTCCCACCGCGTCGGTGGCTCTGTCAATGTTGGCAACCACTTCGCTGCATGGGCGAGTCACGGTCTTAGG
TTGGGTTCGCACAACTACCAGATCGTTGCATCAGAGGGTTTCCAGAGCAGCGGTTCTTCTTCTATCACCGTCAAT
TAA
Transcript >Agabi119p4|571800
ATGGTCTCTATGAAGTCTTTCCTCTTTCTCGCCTCAGCGGCTCTCACCGCTATGGCCATGCCACATTTCGCCAAC
AACACCGAATCTCACCTACTCGTCCCTCGCCAGACTATCAATACTCCTTCCACTGGTTTTGTTGACGGCCACTTC
TACTCCTTGTGGATGCAATCCAGCACCGGTGCCACAATGAATGTTCAGGGCAACTCGTACAGTTTGAACTGGCAA
ACGTCTAGCCAAAACGTTGTCGGTGGAATTGGCTGGAACCCAGGAAGTAGCAGGGTGATCAACTACAGTGGTAAC
TTCAACTGTGCCGCAAACTGCTACCTGTCCATCTACGGGTGGACTGAAAACCCACTCATCGAGTACTACATCGTC
GAATCCTACGGTACCTTTAACCCTGGTAGCCAAGCTCAACTCTTGGGTTCTGTCAATTCTGACGGTGGAACCTAC
AACATCTACCACACCGTCCGCGTGAACCAACCTTCGATCCACGGAACTGCGACGTTCGACCAGTTCTGGTCCGTC
CGCACGTCCCACCGCGTCGGTGGCTCTGTCAATGTTGGCAACCACTTCGCTGCATGGGCGAGTCACGGTCTTAGG
TTGGGTTCGCACAACTACCAGATCGTTGCATCAGAGGGTTTCCAGAGCAGCGGTTCTTCTTCTATCACCGTCAAT
TAA
Gene >Agabi119p4|571800
ATGGTCTCTATGAAGTCTTTCCTCTTTCTCGCCTCAGCGGCTCTCACCGCTATGGCCATGCCACATTTCGCCAAC
AACACCGAATCTCACCTACTCGTCCCTCGCCAGACTATCAATACTCCTTCCACTGGTTTTGTTGACGGCCACTTC
TACTCCTTGTGGATGCAATCCAGCACCGGTGCCACAATGAATGTTCAGGGCAACTCGTACAGTTTGAACTGGCAA
ACGTCTAGCCAAAACGTTGTCGGTGGAATTGGCTGGAACCCAGGAAGTAGCAGGTTCGTGATCATGTTCATATGA
ATCTTCACACTAATGGATGTGACGGTTATCGAATATAGGGTGATCAACTACAGTGGTAACTTCAACTGTGCCGCA
AACTGCTACCTGTCCATCTACGGGTGGACTGAAAACCCACTCATCGAGTACTACATCGTCGAATCCTACGGTACC
TTTAACCCTGGTAGCCAAGCTCAACTCTTGGGTTCTGTCAATTCTGACGGTGGAACCTACAACATCTACCACACC
GTCCGCGTGAACCAACCTTCGATCCACGGAACTGCGACGTTCGACCAGTTCTGGTCCGTCCGCACGTCCCACCGC
GTCGGTGGCTCTGTCAATGTTGGCAACCACTTCGCTGCATGGGCGAGTCACGGTCTTAGGTTGGGTTCGCACAAC
TACCAGATCGTTGCATCAGAGGGTTTCCAGAGCAGCGGTTCTTCTTCTATCACCGTCAATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail