Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|571250
Gene name
Locationscaffold_01b:17347..18681
Strand-
Gene length (bp)1334
Transcript length (bp)978
Coding sequence length (bp)978
Protein length (aa) 326

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17168 DUF5127 Domain of unknown function (DUF5127) 1.7E-70 81 305

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q2U4L7|GTAA_ASPOR Glutaminase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=gtaA PE=1 SV=2 1 305 7.0E-46
sp|D4AMT2|GTAA_ARTBC Probable glutaminase ARB_05535/05536 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05535/05536 PE=1 SV=2 7 306 7.0E-18

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|571250
MLFLYFFLSFGLQAYAQSPGSLGDFPLAVKTPYLHAWARNANQHILAWNAMIRVDGQPYQWLGNSNIANFSTTTS
SEITPTSTIFTIQAGPMKFKATFFTPIEPNDYTRQSIPFTYLFVDGFAADDGNPHTIQLYSDITGEWISHDLSTQ
MNWDTQDSPDNMVYHHLEPRDPKSLIDNADSAEDATVYYPAPKRPGLTWQTGADTDCRIRFAKSGSLLNSKDTNF
RPVNRQWPVFSFAIDLGSITPTTQPDPVVWALGLVRDPLVNYSAGSGFQSRIGYYWSAYHSIDDVISDFLGDFAN
ARVRSHISKPIKNFEGPKMPTKANL*
Coding >Agabi119p4|571250
ATGCTTTTCCTCTACTTCTTCCTTTCCTTTGGGCTACAGGCTTATGCCCAATCTCCCGGTTCACTAGGAGATTTC
CCTCTCGCTGTGAAAACGCCATATCTACATGCCTGGGCTCGGAATGCCAACCAACATATTCTTGCGTGGAATGCG
ATGATTCGGGTAGATGGTCAACCTTACCAGTGGTTGGGCAATTCAAACATCGCCAACTTCTCGACCACAACCTCC
AGCGAAATAACCCCGACTAGCACAATATTTACTATTCAAGCTGGGCCCATGAAATTCAAAGCTACCTTCTTCACC
CCAATCGAGCCAAACGACTATACTCGTCAATCGATCCCATTCACCTATCTTTTCGTTGATGGCTTCGCTGCGGAC
GATGGAAACCCACACACAATCCAACTGTATTCCGACATCACTGGTGAATGGATAAGCCACGACTTGTCGACTCAG
ATGAATTGGGACACACAGGACTCGCCGGACAACATGGTCTATCACCATCTCGAACCACGGGACCCGAAGTCACTG
ATTGATAACGCTGATTCAGCGGAGGACGCAACCGTATACTATCCCGCACCAAAGCGGCCTGGCCTCACTTGGCAG
ACAGGTGCTGATACTGATTGCAGGATTAGGTTTGCGAAGAGCGGTAGTTTGCTCAACTCCAAAGACACCAACTTC
CGTCCTGTGAATAGACAGTGGCCCGTCTTTTCCTTTGCGATAGACTTGGGATCAATCACCCCCACCACTCAACCA
GACCCTGTTGTTTGGGCGCTGGGCCTCGTACGCGATCCCTTAGTCAACTATTCAGCTGGATCGGGGTTTCAATCT
CGAATAGGTTATTACTGGTCAGCATACCACAGTATTGACGATGTGATCTCGGATTTCCTCGGGGATTTTGCTAAT
GCCAGAGTCAGAAGCCACATCAGCAAACCGATAAAAAACTTTGAAGGGCCCAAAATGCCAACTAAGGCAAATTTA
TAA
Transcript >Agabi119p4|571250
ATGCTTTTCCTCTACTTCTTCCTTTCCTTTGGGCTACAGGCTTATGCCCAATCTCCCGGTTCACTAGGAGATTTC
CCTCTCGCTGTGAAAACGCCATATCTACATGCCTGGGCTCGGAATGCCAACCAACATATTCTTGCGTGGAATGCG
ATGATTCGGGTAGATGGTCAACCTTACCAGTGGTTGGGCAATTCAAACATCGCCAACTTCTCGACCACAACCTCC
AGCGAAATAACCCCGACTAGCACAATATTTACTATTCAAGCTGGGCCCATGAAATTCAAAGCTACCTTCTTCACC
CCAATCGAGCCAAACGACTATACTCGTCAATCGATCCCATTCACCTATCTTTTCGTTGATGGCTTCGCTGCGGAC
GATGGAAACCCACACACAATCCAACTGTATTCCGACATCACTGGTGAATGGATAAGCCACGACTTGTCGACTCAG
ATGAATTGGGACACACAGGACTCGCCGGACAACATGGTCTATCACCATCTCGAACCACGGGACCCGAAGTCACTG
ATTGATAACGCTGATTCAGCGGAGGACGCAACCGTATACTATCCCGCACCAAAGCGGCCTGGCCTCACTTGGCAG
ACAGGTGCTGATACTGATTGCAGGATTAGGTTTGCGAAGAGCGGTAGTTTGCTCAACTCCAAAGACACCAACTTC
CGTCCTGTGAATAGACAGTGGCCCGTCTTTTCCTTTGCGATAGACTTGGGATCAATCACCCCCACCACTCAACCA
GACCCTGTTGTTTGGGCGCTGGGCCTCGTACGCGATCCCTTAGTCAACTATTCAGCTGGATCGGGGTTTCAATCT
CGAATAGGTTATTACTGGTCAGCATACCACAGTATTGACGATGTGATCTCGGATTTCCTCGGGGATTTTGCTAAT
GCCAGAGTCAGAAGCCACATCAGCAAACCGATAAAAAACTTTGAAGGGCCCAAAATGCCAACTAAGGCAAATTTA
TAA
Gene >Agabi119p4|571250
ATGCTTTTCCTCTACTTCTTCCTTTCCTTTGGGCTACAGGCTTATGCCCAATCTCCCGGTTCACTAGGAGATTTC
CCTCTCGCTGTGAAAACGCCATATCTACATGCCTGGGCTCGGAATGCCAACCGTAATGCCCCCCAATAAGAATGG
CCGCACCTCTTCACACAAGAACATGTGAGTCGCCGTATGTAATACGCCCAACGGTTATCTTATTGAATTCCTGGA
ATTTAGATTCTTGCGTGGAATGCGATGATTCGGGTAGATGGTCAACCTTACCAGTGGTTGGGCAATTCAAACATC
GCCAACTTCTCGACCACAACCTCCAGCGAAATAACCCCGACTAGCACAATATTTACTATTCAAGCTGGGCCCATG
AAATTCAAAGCTACCTTCTTCACCCCAATCGAGGTTCATTTTCTTCATTGCTCACGATCGCGTTATCCTGAACGT
TAGCACAGCCAAACGACTATACTCGTCAATCGATCCCATTCACCTATCTTTTCGTTGATGGCTTCGCTGCGGACG
ATGGAAACCCACACACAATCCAACTGTATTCCGACATCACTGGTGGTCAGTGTAATCCTCATTGAATACTGTGTC
GAAGGACGCTGATAAATACCTTAGAATGGATAAGCCACGACTTGTCGACTCAGATGAATTGGGACACACAGGACT
CGCCGGACAACATGGTCTATCACCATCTCGAACCACGGGACCCGAAGTCACTGATTGATAACGCTGATTCAGCGG
AGGACGCAACCGTATACTATCCCGCACCAAAGGTGAATAGAATGAGTGCTTCTCTTGGTTCACTTCCTGACCGTT
TTCTACAGCGGCCTGGCCTCACTTGGCAGACAGGTGCTGATACTGATTGCAGGATTAGGTTTGCGAAGAGCGGTA
GTTTGCTCAACTCCAAAGACACCAACTTCCGTCCTGTGAATAGGTGTGTTCTTCCAACAGAATGAGGTCTATCGT
CGACGAATTTCCATCAGACAGTGGCCCGTCTTTTCCTTTGCGATAGACTTGGGATCAATCACCCCCACCACTCAA
CCAGACCCTGTTGTTTGGGCGCTGGGCCTCGTACGCGATCCCTTAGTCAACTATTCAGCTGGATCGGGGTTTCAA
TCTCGAATAGGTTATTACTGGTCAGCATACCACAGTATTGACGATGTGGTACGTGTTCATCCTCATCCCGATACT
CTTGATGACGAATGTGCCAAACTTAGATCTCGGATTTCCTCGGGGATTTTGCTAATGCCAGAGTCAGAAGCCACA
TCAGCAAACCGATAAAAAACTTTGAAGGGCCCAAAATGCCAACTAAGGCAAATTTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail