Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|567500
Gene name
Locationscaffold_01a:3138331..3140590
Strand-
Gene length (bp)2259
Transcript length (bp)1284
Coding sequence length (bp)1284
Protein length (aa) 428

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10 2.5E-93 146 425
PF00734 CBM_1 Fungal cellulose binding domain 2.0E-14 81 108

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q0H904|XYNC_ASPFU Endo-1,4-beta-xylanase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=xlnC PE=2 SV=2 139 427 3.0E-133
sp|G4MPQ7|XYN6_MAGO7 Endo-1,4-beta-xylanase 6 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=XYL6 PE=3 SV=1 65 427 1.0E-130
sp|Q8NJ73|XYN6_MAGGR Endo-1,4-beta-xylanase 6 OS=Magnaporthe grisea GN=XYL6 PE=1 SV=1 65 427 1.0E-130
sp|Q0CBM8|XYNC_ASPTN Probable endo-1,4-beta-xylanase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=xlnC PE=2 SV=2 135 427 3.0E-129
sp|B0Y6E0|XYNC_ASPFC Probable endo-1,4-beta-xylanase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=xlnC PE=2 SV=2 139 427 4.0E-129
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q0H904|XYNC_ASPFU Endo-1,4-beta-xylanase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=xlnC PE=2 SV=2 139 427 3.0E-133
sp|G4MPQ7|XYN6_MAGO7 Endo-1,4-beta-xylanase 6 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=XYL6 PE=3 SV=1 65 427 1.0E-130
sp|Q8NJ73|XYN6_MAGGR Endo-1,4-beta-xylanase 6 OS=Magnaporthe grisea GN=XYL6 PE=1 SV=1 65 427 1.0E-130
sp|Q0CBM8|XYNC_ASPTN Probable endo-1,4-beta-xylanase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=xlnC PE=2 SV=2 135 427 3.0E-129
sp|B0Y6E0|XYNC_ASPFC Probable endo-1,4-beta-xylanase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=xlnC PE=2 SV=2 139 427 4.0E-129
sp|Q4JHP5|XYNC_ASPTE Probable endo-1,4-beta-xylanase C OS=Aspergillus terreus GN=xlnC PE=2 SV=1 135 427 9.0E-129
sp|A1CX14|XYNC_NEOFI Probable endo-1,4-beta-xylanase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=xlnC PE=2 SV=1 136 427 3.0E-127
sp|Q5S7A8|XYNA_PENCN Endo-1,4-beta-xylanase A OS=Penicillium canescens GN=xylA PE=1 SV=1 130 427 5.0E-127
sp|P56588|XYNA_PENSI Endo-1,4-beta-xylanase OS=Penicillium simplicissimum PE=1 SV=1 135 427 1.0E-126
sp|P23360|XYNA_THEAU Endo-1,4-beta-xylanase OS=Thermoascus aurantiacus GN=XYNA PE=1 SV=4 135 427 7.0E-125
sp|Q96VB6|XYNF3_ASPOR Endo-1,4-beta-xylanase F3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=xynF3 PE=1 SV=1 132 427 9.0E-125
sp|O59859|XYNA_ASPAC Endo-1,4-beta-xylanase OS=Aspergillus aculeatus GN=xynIA PE=3 SV=1 135 427 4.0E-124
sp|I1S3C6|XYND_GIBZE Endo-1,4-beta-xylanase D OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=XYLD PE=1 SV=1 62 427 7.0E-123
sp|Q9P8J1|XYNA_TALPU Endo-1,4-beta-xylanase A OS=Talaromyces purpurogenus GN=XynA PE=1 SV=1 131 427 2.0E-122
sp|C5J411|XYNC_ASPNG Probable endo-1,4-beta-xylanase C OS=Aspergillus niger GN=xlnC PE=2 SV=2 135 427 5.0E-122
sp|A2QFV7|XYNC_ASPNC Probable endo-1,4-beta-xylanase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=xlnC PE=1 SV=1 135 427 1.0E-121
sp|W0HFK8|XYN1_RHIOR Endo-1,4-beta-xylanase 1 OS=Rhizopus oryzae GN=xyn1 PE=1 SV=1 130 427 2.0E-120
sp|O94163|XYNF1_ASPOR Endo-1,4-beta-xylanase F1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=xynF1 PE=1 SV=1 132 427 7.0E-120
sp|P33559|XYNA_ASPKW Endo-1,4-beta-xylanase A OS=Aspergillus kawachii (strain NBRC 4308) GN=xynA PE=1 SV=2 135 427 8.0E-120
sp|G4MTF8|XYN2_MAGO7 Endo-1,4-beta-xylanase 2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=XYL2 PE=3 SV=1 126 427 4.0E-119
sp|A1CHQ0|XYNC_ASPCL Probable endo-1,4-beta-xylanase C OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=xlnC PE=2 SV=1 137 427 5.0E-119
sp|P46239|GUNF_FUSOX Putative endoglucanase type F OS=Fusarium oxysporum PE=2 SV=1 65 417 5.0E-117
sp|Q00177|XYNC_EMENI Endo-1,4-beta-xylanase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=xlnC PE=1 SV=1 133 427 5.0E-116
sp|Q6PRW6|XYN_PENCH Endo-1,4-beta-xylanase OS=Penicillium chrysogenum GN=Xyn PE=1 SV=1 131 421 9.0E-115
sp|P29417|XYNA_PENCH Endo-1,4-beta-xylanase OS=Penicillium chrysogenum GN=XYLP PE=1 SV=2 131 421 3.0E-114
sp|B8NXJ2|XYNF3_ASPFN Probable endo-1,4-beta-xylanase F3 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=xynF3 PE=2 SV=1 132 427 3.0E-114
sp|B8NER4|XYNF1_ASPFN Probable endo-1,4-beta-xylanase F1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=xynF1 PE=3 SV=1 132 427 1.0E-112
sp|I1S3T9|XYNC_GIBZE Endo-1,4-beta-xylanase C OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=XYLC PE=1 SV=1 135 427 3.0E-106
sp|Q4P902|XIN1_USTMA Endo-1,4-beta-xylanase UM03411 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_03411 PE=1 SV=1 132 427 4.0E-106
sp|O74717|XYN2_CLAPU Endo-1,4-beta-xylanase 2 OS=Claviceps purpurea GN=xyl2 PE=2 SV=1 128 424 6.0E-105
sp|Q01176|XYN2_MAGGR Endo-1,4-beta-xylanase 2 OS=Magnaporthe grisea GN=XYL2 PE=1 SV=1 126 427 1.0E-104
sp|B7SIW2|XYNC_PHACH Endo-1,4-beta-xylanase C OS=Phanerochaete chrysosporium GN=xynC PE=1 SV=1 76 423 9.0E-98
sp|Q9HEZ1|XYNA_PHACH Endo-1,4-beta-xylanase A OS=Phanerochaete chrysosporium GN=xynA PE=1 SV=1 76 423 1.0E-93
sp|O60206|XLNA_AGABI Endo-1,4-beta-xylanase OS=Agaricus bisporus GN=xlnA PE=2 SV=1 133 425 6.0E-71
sp|B3A0S5|XYNA_FUSO4 Endo-1,4-beta-xylanase A OS=Fusarium oxysporum f. sp. lycopersici (strain 4287 / CBS 123668 / FGSC 9935 / NRRL 34936) GN=FOXG_17421 PE=1 SV=1 135 427 3.0E-70
sp|Q2PGV8|XYN2_AURPU Endo-1,4-beta-xylanase 2 OS=Aureobasidium pullulans GN=xynII PE=1 SV=1 125 427 8.0E-70
sp|I1RQU5|XYN1_GIBZE Endo-1,4-beta-xylanase 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=XYL1 PE=1 SV=1 137 427 1.0E-67
sp|P26514|XYNA_STRLI Endo-1,4-beta-xylanase A OS=Streptomyces lividans GN=xlnA PE=1 SV=2 141 427 7.0E-63
sp|P79046|XYN1_HUMGT Endo-1,4-beta-xylanase 1 OS=Humicola grisea var. thermoidea GN=xyn1 PE=2 SV=1 147 427 2.0E-62
sp|G4MLU0|XYN5_MAGO7 Endo-1,4-beta-xylanase 5 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=XYL5 PE=3 SV=1 130 420 1.0E-57
sp|Q8J1Y4|XYN5_MAGGR Endo-1,4-beta-xylanase 5 OS=Magnaporthe grisea GN=XYL5 PE=3 SV=1 130 420 1.0E-57
sp|B4XVN1|XYNA_STRSQ Endo-1,4-beta-xylanase A OS=Streptomyces sp. GN=xynAS9 PE=1 SV=1 135 427 3.0E-57
sp|P07986|GUX_CELFI Exoglucanase/xylanase OS=Cellulomonas fimi GN=cex PE=1 SV=1 151 427 1.0E-56
sp|Q5ZNB1|XYND_TALFU Endo-1,4-beta-xylanase D OS=Talaromyces funiculosus GN=xynD PE=1 SV=1 139 427 2.0E-52
sp|P10478|XYNZ_CLOTH Endo-1,4-beta-xylanase Z OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=xynZ PE=1 SV=3 117 427 5.0E-50
sp|Q60041|XYNB_THENE Endo-1,4-beta-xylanase B OS=Thermotoga neapolitana GN=xynB PE=3 SV=1 172 423 3.0E-47
sp|P36917|XYNA_THESA Endo-1,4-beta-xylanase A OS=Thermoanaerobacterium saccharolyticum GN=xynA PE=1 SV=1 148 425 3.0E-46
sp|P38535|XYNX_CLOTM Exoglucanase XynX OS=Clostridium thermocellum GN=xynX PE=3 SV=1 143 423 4.0E-45
sp|Q12603|XYNA_DICTH Beta-1,4-xylanase OS=Dictyoglomus thermophilum GN=xynA PE=3 SV=1 148 425 3.0E-42
sp|P49942|XYNA_BACOV Endo-1,4-beta-xylanase A OS=Bacteroides ovatus GN=xylI PE=2 SV=1 168 424 1.0E-40
sp|P45703|XYN2_GEOSE Endo-1,4-beta-xylanase OS=Geobacillus stearothermophilus GN=xynA PE=1 SV=1 151 425 3.0E-38
sp|Q59675|XY10C_CELJA Endo-beta-1,4-xylanase Xyn10C OS=Cellvibrio japonicus GN=xyn10C PE=1 SV=2 156 427 1.0E-37
sp|O69230|XYNC_PAEBA Endo-1,4-beta-xylanase C OS=Paenibacillus barcinonensis GN=xynC PE=1 SV=1 151 425 2.0E-37
sp|P23556|XYNA_CALSA Endo-1,4-beta-xylanase A OS=Caldicellulosiruptor saccharolyticus GN=xynA PE=1 SV=1 139 424 2.0E-37
sp|P40944|XYNA_CALSR Endo-1,4-beta-xylanase A OS=Caldicellulosiruptor sp. (strain Rt8B.4) GN=xynA PE=3 SV=1 126 425 5.0E-37
sp|P40943|XYN1_GEOSE Endo-1,4-beta-xylanase OS=Geobacillus stearothermophilus PE=1 SV=1 124 413 6.0E-37
sp|P07528|XYNA_BACHD Endo-1,4-beta-xylanase A OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=xynA PE=1 SV=1 143 425 5.0E-36
sp|Q02290|XYNB_NEOPA Endo-1,4-beta-xylanase B OS=Neocallimastix patriciarum GN=xynB PE=2 SV=1 170 427 1.0E-35
sp|P14768|XYNA_CELJU Endo-1,4-beta-xylanase A OS=Cellvibrio japonicus (strain Ueda107) GN=xynA PE=1 SV=2 163 427 3.0E-35
sp|O69231|XYNB_PAEBA Endo-1,4-beta-xylanase B OS=Paenibacillus barcinonensis GN=xynB PE=1 SV=1 151 424 2.0E-33
sp|Q60042|XYNA_THENE Endo-1,4-beta-xylanase A OS=Thermotoga neapolitana GN=xynA PE=1 SV=1 167 424 5.0E-33
sp|P48789|XYNA_PRERU Endo-1,4-beta-xylanase A OS=Prevotella ruminicola GN=xynA PE=3 SV=1 169 424 6.0E-33
sp|Q60037|XYNA_THEMA Endo-1,4-beta-xylanase A OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=xynA PE=1 SV=1 168 424 7.0E-33
sp|C6CRV0|XYNA1_PAESJ Endo-1,4-beta-xylanase A OS=Paenibacillus sp. (strain JDR-2) GN=xynA1 PE=1 SV=1 168 425 5.0E-32
sp|P40942|CEXY_CLOSR Thermostable celloxylanase OS=Clostridium stercorarium GN=xynB PE=1 SV=1 179 425 9.0E-31
sp|P29126|XYNA_RUMFL Bifunctional endo-1,4-beta-xylanase XylA OS=Ruminococcus flavefaciens GN=xynA PE=3 SV=1 139 424 2.0E-27
sp|P26223|XYNB_BUTFI Endo-1,4-beta-xylanase B OS=Butyrivibrio fibrisolvens GN=xynB PE=3 SV=1 152 426 3.0E-27
sp|P10474|GUNB_CALSA Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus GN=celB PE=3 SV=1 150 426 4.0E-27
sp|D5EY13|XYFA_PRER2 Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) GN=xyn10D-fae1A PE=1 SV=1 134 423 2.0E-26
sp|P51584|XYNY_CLOTM Endo-1,4-beta-xylanase Y OS=Clostridium thermocellum GN=xynY PE=1 SV=1 152 423 2.0E-25
sp|P23551|XYNA_BUTFI Endo-1,4-beta-xylanase A OS=Butyrivibrio fibrisolvens GN=xynA PE=3 SV=1 162 427 5.0E-21
sp|P23030|XYNB_CELJU Endo-1,4-beta-xylanase B OS=Cellvibrio japonicus (strain Ueda107) GN=xynB PE=1 SV=2 148 425 3.0E-17
sp|P49075|GUX3_AGABI Exoglucanase 3 OS=Agaricus bisporus GN=cel3 PE=1 SV=1 76 113 3.0E-16
sp|P07982|GUN2_HYPJE Endoglucanase EG-II OS=Hypocrea jecorina GN=egl2 PE=1 SV=1 58 127 2.0E-14
sp|P07987|GUX2_HYPJE Exoglucanase 2 OS=Hypocrea jecorina GN=cbh2 PE=1 SV=1 76 152 1.0E-12
sp|P07529|XYNA_CRYAL Endo-1,4-beta-xylanase OS=Cryptococcus albidus PE=1 SV=2 127 224 1.0E-12
sp|G0RV93|CIP2_HYPJQ 4-O-methyl-glucuronoyl methylesterase OS=Hypocrea jecorina (strain QM6a) GN=cip2 PE=1 SV=1 64 115 3.0E-12
sp|Q4WFK4|CBHC_ASPFU Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cbhC PE=3 SV=1 58 114 5.0E-12
sp|B0XWL3|CBHC_ASPFC Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=cbhC PE=3 SV=1 58 114 5.0E-12
sp|P23557|XYN4_CALSA Putative endo-1,4-beta-xylanase OS=Caldicellulosiruptor saccharolyticus PE=3 SV=1 203 367 7.0E-12
sp|A1DJQ7|CBHC_NEOFI Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=cbhC PE=3 SV=1 58 114 7.0E-12
sp|Q7SDR1|GUN3_NEUCR Endoglucanase gh5-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gh5-1 PE=1 SV=1 63 136 8.0E-12
sp|B2ABX7|CEL6A_PODAN 1,4-beta-D-glucan cellobiohydrolase CEL6A OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=CEL6A PE=1 SV=1 79 120 3.0E-11
sp|Q0CFP1|CBHC_ASPTN Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cbhC PE=3 SV=1 76 113 5.0E-11
sp|Q9C1S9|GUX6_HUMIN Exoglucanase-6A OS=Humicola insolens GN=cel6A PE=1 SV=1 81 115 6.0E-11
sp|Q5AR04|MANF_EMENI Probable mannan endo-1,4-beta-mannosidase F OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=manF PE=3 SV=2 65 114 2.0E-10
sp|G4MM92|CEL6A_MAGO7 1,4-beta-D-glucan cellobiohydrolase CEL6A OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=cel6A PE=1 SV=1 67 114 3.0E-10
sp|Q06886|GUX1_PENJA Exoglucanase 1 OS=Penicillium janthinellum GN=cbh1 PE=2 SV=1 81 112 4.0E-10
sp|A1CCN4|CBHC_ASPCL Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cbhC PE=3 SV=1 76 114 4.0E-10
sp|A1C8U0|MANF_ASPCL Mannan endo-1,4-beta-mannosidase F OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=manF PE=3 SV=1 62 137 4.0E-09
sp|O59843|CBHB_ASPAC 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus aculeatus GN=cbhB PE=2 SV=1 75 112 4.0E-09
sp|P46236|GUNB_FUSOX Putative endoglucanase type B OS=Fusarium oxysporum PE=2 SV=1 80 125 4.0E-09
sp|A2QYR9|CBHC_ASPNC Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cbhC PE=3 SV=1 56 113 5.0E-09
sp|Q5B2E8|CBHC_EMENI 1,4-beta-D-glucan cellobiohydrolase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cbhC PE=1 SV=2 65 113 5.0E-09
sp|Q4WBW4|AXE1_ASPFU Probable acetylxylan esterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=axeA PE=3 SV=1 81 112 8.0E-09
sp|Q0CMT2|CBHB_ASPTN Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cbhB PE=3 SV=1 81 112 9.0E-09
sp|Q12624|GUN3_HUMIN Endoglucanase 3 OS=Humicola insolens GN=CMC3 PE=1 SV=1 69 113 1.0E-08
sp|Q8WZJ4|XYNA_TALFU 1,4-beta-D-glucan cellobiohydrolase xynA OS=Talaromyces funiculosus GN=xynA PE=1 SV=1 79 112 1.0E-08
sp|P07529|XYNA_CRYAL Endo-1,4-beta-xylanase OS=Cryptococcus albidus PE=1 SV=2 285 427 2.0E-08
sp|A2QAI7|CBHB_ASPNC Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cbhB PE=3 SV=1 76 112 2.0E-08
sp|Q9UVS8|CBHB_ASPNG 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus niger GN=cbhB PE=2 SV=1 76 112 2.0E-08
sp|A1DBP9|AXE1_NEOFI Probable acetylxylan esterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=axeA PE=3 SV=1 79 112 2.0E-08
sp|A1DNL0|CBHB_NEOFI Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=cbhB PE=3 SV=1 75 112 2.0E-08
sp|Q92400|GUX2_AGABI Exoglucanase OS=Agaricus bisporus GN=cel2 PE=2 SV=1 78 112 3.0E-08
sp|A8PB24|AXE1_COPC7 Acetylxylan esterase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CC1G_12850 PE=1 SV=1 63 116 3.0E-08
sp|P43317|GUN5_HYPJE Endoglucanase-5 OS=Hypocrea jecorina GN=egl5 PE=3 SV=1 76 113 4.0E-08
sp|Q8NJP6|AXE1_TALPU Acetylxylan esterase A OS=Talaromyces purpurogenus GN=axeA PE=1 SV=1 79 112 5.0E-08
sp|G2Q9T3|CEL61_MYCTT Polysaccharide monooxygenase Cel61a OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) GN=Cel61a PE=1 SV=1 78 112 8.0E-08
sp|Q8J0K5|XYNB_TALFU Endo-1,4-beta-xylanase B OS=Talaromyces funiculosus GN=xynB PE=1 SV=1 79 111 9.0E-08
sp|Q4WM08|CBHB_ASPFU Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cbhB PE=1 SV=1 75 112 1.0E-07
sp|B0Y8K2|CBHB_ASPFC Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=cbhB PE=3 SV=1 75 112 1.0E-07
sp|A1DBV1|MANF_NEOFI Probable mannan endo-1,4-beta-mannosidase F OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=manF PE=3 SV=1 76 118 2.0E-07
sp|Q9P8P3|GUX1_TRIHA Exoglucanase 1 OS=Trichoderma harzianum GN=cbh1 PE=1 SV=1 72 112 2.0E-07
sp|P79046|XYN1_HUMGT Endo-1,4-beta-xylanase 1 OS=Humicola grisea var. thermoidea GN=xyn1 PE=2 SV=1 77 112 7.0E-07
sp|Q5ZNB1|XYND_TALFU Endo-1,4-beta-xylanase D OS=Talaromyces funiculosus GN=xynD PE=1 SV=1 81 112 7.0E-07
sp|Q99034|AXE1_HYPJE Acetylxylan esterase OS=Hypocrea jecorina GN=axe1 PE=1 SV=1 78 112 8.0E-07
sp|B8M9H9|FAEB_TALSN Feruloyl esterase B OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=faeB PE=1 SV=1 79 112 8.0E-07
sp|Q4WBS1|MANF_ASPFU Mannan endo-1,4-beta-mannosidase F OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=manF PE=1 SV=2 62 113 9.0E-07
sp|B0Y9E7|MANF_ASPFC Probable mannan endo-1,4-beta-mannosidase F OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=manF PE=3 SV=2 62 113 9.0E-07
sp|G2QCS4|CEL7A_MYCTT Endoglucanase 7a OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) GN=eg7A PE=1 SV=1 74 112 1.0E-06
sp|A1CU44|CBHB_ASPCL Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cbhB PE=3 SV=1 81 112 2.0E-06
sp|Q02290|XYNB_NEOPA Endo-1,4-beta-xylanase B OS=Neocallimastix patriciarum GN=xynB PE=2 SV=1 79 112 3.0E-06
sp|Q7Z9M8|XG74_HYPJQ Xyloglucanase OS=Hypocrea jecorina (strain QM6a) GN=cel74a PE=1 SV=1 83 112 4.0E-06
sp|E7EF85|XYNB_PENOX Endo-1,4-beta-xylanase B OS=Penicillium oxalicum GN=xynB PE=1 SV=1 79 112 4.0E-06
sp|Q12714|GUN1_TRILO Endoglucanase EG-1 OS=Trichoderma longibrachiatum GN=egl1 PE=3 SV=1 81 112 5.0E-06
sp|B7SIW1|XYNB_PHACH Endo-1,4-beta-xylanase B OS=Phanerochaete chrysosporium GN=xynB PE=1 SV=1 79 112 5.0E-06
sp|B2ADA5|GH6D_PODAN Probable exoglucanase GH6D OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=GH6D PE=3 SV=1 79 112 7.0E-06
sp|P07981|GUN1_HYPJE Endoglucanase EG-1 OS=Hypocrea jecorina GN=egl1 PE=1 SV=1 81 112 8.0E-06
sp|P46238|GUXC_FUSOX Putative exoglucanase type C OS=Fusarium oxysporum PE=2 SV=1 81 111 8.0E-06
sp|P50272|PSBP_PORPU Putative polysaccharide-binding protein OS=Porphyra purpurea PE=2 SV=1 62 193 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0030248 cellulose binding Yes
GO:0005576 extracellular region Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0030247 polysaccharide binding No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:0030246 carbohydrate binding No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|567500
MVARTPSSSDHGFRLFLGLTRSYLTRLSSTTCKKRGKETVLLHLGIRFVEKFSRTFEMNKYLAFISLAVFTSQAV
AQQAVWGQCGGNGWTGPTTCVSGSTCVKQNDFYSQCLPGTAPTTTPTTQPPTTTTNSPSAGTGLNGKFTSRGKKF
FGAAADQNTINIAANQALLISDFGAVTPENSMKWDATEPNRGQFNFGGADFLVNWATSHGKMIRGHTFVWHSQLP
GWVSSINDRTTLTSVIQNHISTLGGSRKWDVCNEIFNEDGSIRQSVFSNVLGESFVTIAFQAARSADPNAKLYIN
DYNLDSNNAKVQGMVALVKRQNANGRIIDGIGTQMHLGPGGGSGAQAAITALAGAGTELAITELDIQNASSSDYV
AVVNACLNQPACVSITTWGVADINSWRSGSSPLLFDNNYRPKAAYNAVINAL*
Coding >Agabi119p4|567500
ATGGTGGCCAGAACGCCATCTAGTTCTGATCACGGCTTTAGGCTTTTTCTGGGACTTACACGATCATATTTGACG
CGGTTGTCTTCGACCACATGTAAAAAACGTGGCAAAGAGACTGTTTTACTTCATTTAGGAATAAGATTCGTGGAG
AAATTTAGCAGGACCTTCGAAATGAACAAATACCTTGCTTTCATCTCTCTCGCCGTCTTCACCAGCCAAGCTGTT
GCTCAGCAGGCCGTTTGGGGGCAATGTGGTGGTAACGGATGGACTGGGCCGACAACTTGTGTCTCTGGATCAACG
TGTGTAAAGCAAAATGACTTTTACTCTCAGTGTCTTCCCGGTACTGCCCCGACCACAACACCTACAACCCAGCCC
CCGACAACGACAACGAACTCACCTTCAGCCGGTACTGGTCTTAACGGTAAATTCACTTCTCGTGGCAAGAAATTC
TTCGGCGCTGCTGCCGACCAAAACACCATCAATATTGCTGCCAACCAGGCTCTATTGATATCTGATTTCGGTGCT
GTGACGCCGGAAAATTCTATGAAGTGGGACGCCACGGAACCCAACAGAGGACAGTTCAACTTCGGTGGGGCTGAC
TTCCTCGTCAACTGGGCTACTTCCCACGGCAAGATGATCCGTGGCCACACTTTCGTCTGGCACTCTCAGCTTCCC
GGCTGGGTTTCTTCTATTAATGATAGGACTACCTTGACATCTGTAATCCAAAACCACATCTCAACTCTTGGTGGC
AGCCGTAAGTGGGATGTTTGCAACGAAATCTTCAACGAAGATGGCTCAATTCGTCAATCAGTCTTCTCTAATGTC
CTTGGCGAGTCCTTCGTTACCATCGCCTTCCAAGCCGCACGCAGTGCAGATCCGAATGCCAAGTTGTACATAAAC
GACTATAACCTCGACTCCAATAATGCCAAGGTTCAGGGAATGGTTGCTCTTGTCAAGCGTCAGAATGCAAACGGC
AGGATCATTGACGGTATCGGTACACAAATGCATCTTGGTCCTGGAGGTGGTAGTGGCGCTCAGGCTGCTATTACT
GCCCTTGCTGGAGCTGGTACCGAACTCGCTATCACTGAGTTGGATATCCAAAATGCTTCTTCTTCCGACTACGTT
GCTGTTGTCAATGCCTGCTTGAACCAGCCTGCCTGTGTTTCCATTACCACATGGGGTGTTGCCGATATTAACTCG
TGGCGCTCGGGTTCCTCACCCTTGCTGTTTGACAACAACTACCGACCCAAAGCTGCATATAACGCTGTTATCAAT
GCCCTGTAG
Transcript >Agabi119p4|567500
ATGGTGGCCAGAACGCCATCTAGTTCTGATCACGGCTTTAGGCTTTTTCTGGGACTTACACGATCATATTTGACG
CGGTTGTCTTCGACCACATGTAAAAAACGTGGCAAAGAGACTGTTTTACTTCATTTAGGAATAAGATTCGTGGAG
AAATTTAGCAGGACCTTCGAAATGAACAAATACCTTGCTTTCATCTCTCTCGCCGTCTTCACCAGCCAAGCTGTT
GCTCAGCAGGCCGTTTGGGGGCAATGTGGTGGTAACGGATGGACTGGGCCGACAACTTGTGTCTCTGGATCAACG
TGTGTAAAGCAAAATGACTTTTACTCTCAGTGTCTTCCCGGTACTGCCCCGACCACAACACCTACAACCCAGCCC
CCGACAACGACAACGAACTCACCTTCAGCCGGTACTGGTCTTAACGGTAAATTCACTTCTCGTGGCAAGAAATTC
TTCGGCGCTGCTGCCGACCAAAACACCATCAATATTGCTGCCAACCAGGCTCTATTGATATCTGATTTCGGTGCT
GTGACGCCGGAAAATTCTATGAAGTGGGACGCCACGGAACCCAACAGAGGACAGTTCAACTTCGGTGGGGCTGAC
TTCCTCGTCAACTGGGCTACTTCCCACGGCAAGATGATCCGTGGCCACACTTTCGTCTGGCACTCTCAGCTTCCC
GGCTGGGTTTCTTCTATTAATGATAGGACTACCTTGACATCTGTAATCCAAAACCACATCTCAACTCTTGGTGGC
AGCCGTAAGTGGGATGTTTGCAACGAAATCTTCAACGAAGATGGCTCAATTCGTCAATCAGTCTTCTCTAATGTC
CTTGGCGAGTCCTTCGTTACCATCGCCTTCCAAGCCGCACGCAGTGCAGATCCGAATGCCAAGTTGTACATAAAC
GACTATAACCTCGACTCCAATAATGCCAAGGTTCAGGGAATGGTTGCTCTTGTCAAGCGTCAGAATGCAAACGGC
AGGATCATTGACGGTATCGGTACACAAATGCATCTTGGTCCTGGAGGTGGTAGTGGCGCTCAGGCTGCTATTACT
GCCCTTGCTGGAGCTGGTACCGAACTCGCTATCACTGAGTTGGATATCCAAAATGCTTCTTCTTCCGACTACGTT
GCTGTTGTCAATGCCTGCTTGAACCAGCCTGCCTGTGTTTCCATTACCACATGGGGTGTTGCCGATATTAACTCG
TGGCGCTCGGGTTCCTCACCCTTGCTGTTTGACAACAACTACCGACCCAAAGCTGCATATAACGCTGTTATCAAT
GCCCTGTAG
Gene >Agabi119p4|567500
ATGGTGGCCAGAACGCCATCTAGTTCTGATCACGGCTTTAGGCTTTTTCTGGGACTTACACGATCATATTTGACG
CGGTTGTCTTCGACCACATGTAAAAAACGTGGCAAAGAGACTGTTTTACTTCATTTAGGAATAAGATTCGTGGAG
GTAATTCCGAAGTTGGACCGCCAGTACTACCAGACCTCGGAAGATTGACGAGTGGCGGGTCAAATGACAACTGTA
ACGTCGAACTTCGGCTCTTTCGTCGGAGAAATTTAGCAGGTAGCAGTTTTAATTCTCTGCAATTTATAAAGCCGA
CGAAACAAACCTAACTCGTAGGACCTTCGAAATGAACAAATACCTTGCTTTCATCTCTCTCGCCGTCTTCACCAG
CCAAGCTGTTGCTCAGCAGGCCGTTTGGGGGCAATGTCAGTGGCCGATACCACCGAAAGTACATTCGCTGACTCT
GTTCCTTATTTAGGTGGTGGTAACGGATGGACTGGGCCGGTCAGTATCGTTCTTTTGCTTTCATTGATTTCTTGC
TGAAACCCCGACAGACAACTTGTTAGTTACGCTGTTAAAATAGGTGCAGTCGATCATGCAGACTGACTTTTTCAA
GGTGTCTCTGGATCAACGTGTGTAAAGCAAAATGACTTTTACTCTCAGTATGTGGCGCGAGTGCAAGAATTCTTC
CCATTAACAAACATACGCAGGTGTCTTCCCGGTACTGCCCCGACCACAACACCTACAACCCAGCCCCCGACAACG
ACAACGAACTCACCTTCAGCCGGTACTGGTCTTAACGGTAAATTCACTTCTCGTGGCAAGAAATTCTTCGTAAGT
TCGAACGATTTCACTCAACCAGAATTTCAAACATACTCCTTGTATAGGGCGCTGCTGCCGACCAAAACACCATCA
ATATTGCTGGTACGAGACTGCTTTCATTTTTTTCAAGGAAGCGATCTGACTCGATGGGTTAGCCAACCAGGCTCT
ATTGATATCTGATTTCGGTGCTGTGACGCCGGAAAATTCTATGAAGGTGCGCGCATATCTTCGAACCAATGAGTA
TGTTCTCACTCAGTAGATAGTGGGACGCCACGGAACGTAAGCCATCCTCTTGAACCTCGATACGCTCAAGCTGCC
ATTCTAATTTATCTCCTCAGCCAACAGAGGACAGTTCAACTTCGGTGGGGCTGACTTCCTCGTCAACTGGGCTAC
TTCCCACGGCAAGATGATCCGTGGCCACACTTTCGGTAAAATCGTCACCTGTGCTCAATCATGATGTTCTAATTA
TGATCATCAGTCTGGCACTCTCAGCTTCCCGGCTGGGTTTCTTCTATTAATGATAGGACTACCTTGGTGCGTTTT
CTGGCGAGTTTAATCGCATGAGCAGTTACTCAACATTCCATTCTAGACATCTGTAATCCAAAACCACATCTCAAC
TCTTGGTGGCAGGTACAGGGGCAAAATCTATGGTGAGTCATAGTCATTCTTCTATCCTTAAGCTGAGGTTTAATC
GCCATTTGTCCAGCCGTAAGGTTTCATTAATGTCGTCAAATGAGTATATTGTATCTGACGTCAGACTTCTTTCGC
AATAGTGGGATGTTTGCAAGTGAGTATCTACTCTACGAGAATAAGCGAAAACTAATGAAATTGCTTAGCGAAATC
TTCAACGAAGATGGCTCAATTCGTCAATCAGTCTTCTCTAATGTCCTTGGCGAGGTATGTCCCTATCCCTCCTCC
GGCTCATACAGACTTTCCAATGAGGTGTACAGTCCTTCGTTACCATCGCCTTCCAAGCCGCACGCAGTGCAGATC
CGAATGCCAAGTTGTACATAAACGACTATAACCTCGACTCCAATAATGCCAAGGTTCAGGGAATGGTTGCTCTTG
TCAAGCGTCAGAATGCAAACGGCAGGATCATTGACGGTATCGGTACACAAATGCATCTTGGTCCTGGAGGTGGTA
GTGGCGCTCAGGCTGCTATTACTGCCCTTGCTGGAGCTGGTACCGAACTCGCTATCACTGAGTTGGATATCCAAA
ATGCTTCTTCTTCCGACTACGTTGCTGTTGTCAATGCCTGCTTGAACCAGCCTGCCTGTGTTTCCATTACCACAT
GGGGTGTTGCCGATATTGTAAGTCGGAGTTTGTTTCATCCGAAAGTGAGTGAACTCACCGCGTTGTCAGAACTCG
TGGCGCTCGGGTTCCTCACCCTTGCTGTTTGACAACAACTACCGACCCAAAGCTGCATATAACGCTGTTATCAAT
GCCCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail