Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|561900
Gene name
Locationscaffold_01a:2219394..2220921
Strand-
Gene length (bp)1527
Transcript length (bp)1224
Coding sequence length (bp)1224
Protein length (aa) 408

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12706 Lactamase_B_2 Beta-lactamase superfamily domain 3.9E-17 88 220
PF00753 Lactamase_B Metallo-beta-lactamase superfamily 1.7E-05 87 146

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74545|YCV6_SCHPO Putative hydrolase C777.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC777.06c PE=4 SV=1 25 350 2.0E-56
sp|Q7MUY1|LIPB_PORGI Octanoyltransferase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=lipB PE=3 SV=1 24 225 2.0E-10

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|561900
MEFPSTSMRPDIASSPTESNEPAIELVFLGTGTSSSTPHVDCLTADFTTRPPCKTCLSTLTPDGKKNIRRNTGAV
VRTKAKDGRSVTVVIDAGKTFQAAAVEWFPKFGLRRIDALLITHAHADAINGLDDLRGWTLNKAIQSHIDVYLSQ
ETFIELQRSFPYLISKEFASGGGDVPAFRYHIINDGEPFEIEDTGINVTPFAVHHGRIFSRLPPAGYVITPTATL
PSTPNKSDIRALSPEPGEQKFGECVAKEQPEATIHPLLCFGFKIQEQLVYISDVSHIPDHVWGTLQSKRGDSAQQ
LPVLVLDCLRLRPFISHLGIADALMIAKKIGATKTYLTGFSHEVTHEEYVTITEAIGGKLKNKNDLTESEKTGLE
LVQGGGQIWVRPAHDGLRLIINKDGSVYDESY*
Coding >Agabi119p4|561900
ATGGAATTCCCTTCAACTTCTATGCGACCCGATATCGCAAGCTCTCCCACCGAATCGAATGAACCTGCCATTGAG
CTCGTCTTCCTCGGTACTGGGACATCTTCAAGTACACCTCATGTCGACTGTCTGACCGCCGACTTCACAACACGT
CCACCGTGCAAAACATGTCTTTCGACACTTACTCCCGATGGCAAAAAAAACATTCGACGGAATACTGGTGCAGTG
GTTAGAACGAAAGCAAAAGATGGTCGCTCGGTGACCGTTGTTATCGATGCCGGCAAGACTTTTCAGGCTGCGGCA
GTCGAGTGGTTCCCCAAATTTGGTCTGCGAAGGATCGATGCTCTATTGATAACTCATGCTCATGCCGACGCTATT
AATGGACTTGATGACCTCAGAGGCTGGACCTTGAACAAAGCAATTCAATCCCATATTGATGTCTACTTGTCGCAA
GAAACGTTTATTGAGCTACAGAGATCGTTTCCGTACCTCATATCCAAAGAATTCGCGTCGGGCGGAGGAGATGTC
CCAGCCTTCCGGTATCACATCATCAATGATGGTGAGCCATTCGAGATAGAGGACACTGGTATCAATGTCACGCCT
TTTGCTGTTCATCACGGGCGCATCTTCTCAAGACTGCCACCTGCAGGTTATGTTATCACTCCGACTGCGACTCTA
CCATCTACACCAAACAAGTCGGATATCAGAGCACTTTCTCCGGAGCCGGGGGAACAGAAGTTCGGAGAGTGTGTG
GCAAAGGAGCAACCTGAAGCGACTATACACCCCTTACTGTGCTTTGGATTCAAGATTCAAGAGCAGTTGGTGTAC
ATCTCGGATGTCTCCCATATACCAGATCATGTTTGGGGCACGTTGCAGAGTAAACGGGGGGATAGTGCACAACAA
TTGCCAGTTCTAGTGCTGGATTGTCTGCGTCTGCGTCCCTTTATCTCACACCTCGGAATTGCAGATGCATTGATG
ATCGCGAAGAAGATTGGGGCGACGAAGACTTACTTGACTGGTTTCAGCCATGAGGTCACTCACGAAGAATACGTG
ACGATCACCGAAGCTATTGGTGGGAAGTTGAAGAATAAAAACGATTTGACCGAGTCGGAAAAGACTGGCCTCGAA
CTCGTTCAGGGCGGAGGGCAAATCTGGGTTAGACCAGCGCATGATGGGCTCAGACTGATCATAAACAAAGATGGT
AGTGTGTACGATGAAAGCTATTGA
Transcript >Agabi119p4|561900
ATGGAATTCCCTTCAACTTCTATGCGACCCGATATCGCAAGCTCTCCCACCGAATCGAATGAACCTGCCATTGAG
CTCGTCTTCCTCGGTACTGGGACATCTTCAAGTACACCTCATGTCGACTGTCTGACCGCCGACTTCACAACACGT
CCACCGTGCAAAACATGTCTTTCGACACTTACTCCCGATGGCAAAAAAAACATTCGACGGAATACTGGTGCAGTG
GTTAGAACGAAAGCAAAAGATGGTCGCTCGGTGACCGTTGTTATCGATGCCGGCAAGACTTTTCAGGCTGCGGCA
GTCGAGTGGTTCCCCAAATTTGGTCTGCGAAGGATCGATGCTCTATTGATAACTCATGCTCATGCCGACGCTATT
AATGGACTTGATGACCTCAGAGGCTGGACCTTGAACAAAGCAATTCAATCCCATATTGATGTCTACTTGTCGCAA
GAAACGTTTATTGAGCTACAGAGATCGTTTCCGTACCTCATATCCAAAGAATTCGCGTCGGGCGGAGGAGATGTC
CCAGCCTTCCGGTATCACATCATCAATGATGGTGAGCCATTCGAGATAGAGGACACTGGTATCAATGTCACGCCT
TTTGCTGTTCATCACGGGCGCATCTTCTCAAGACTGCCACCTGCAGGTTATGTTATCACTCCGACTGCGACTCTA
CCATCTACACCAAACAAGTCGGATATCAGAGCACTTTCTCCGGAGCCGGGGGAACAGAAGTTCGGAGAGTGTGTG
GCAAAGGAGCAACCTGAAGCGACTATACACCCCTTACTGTGCTTTGGATTCAAGATTCAAGAGCAGTTGGTGTAC
ATCTCGGATGTCTCCCATATACCAGATCATGTTTGGGGCACGTTGCAGAGTAAACGGGGGGATAGTGCACAACAA
TTGCCAGTTCTAGTGCTGGATTGTCTGCGTCTGCGTCCCTTTATCTCACACCTCGGAATTGCAGATGCATTGATG
ATCGCGAAGAAGATTGGGGCGACGAAGACTTACTTGACTGGTTTCAGCCATGAGGTCACTCACGAAGAATACGTG
ACGATCACCGAAGCTATTGGTGGGAAGTTGAAGAATAAAAACGATTTGACCGAGTCGGAAAAGACTGGCCTCGAA
CTCGTTCAGGGCGGAGGGCAAATCTGGGTTAGACCAGCGCATGATGGGCTCAGACTGATCATAAACAAAGATGGT
AGTGTGTACGATGAAAGCTATTGA
Gene >Agabi119p4|561900
ATGGAATTCCCTTCAACTTCTATGCGACCCGATATCGCAAGCTCTCCCACCGAATCGAATGAACCTGCCATTGAG
CTCGTCTTCCTCGGTACTGGGACATCTTCAAGTACACCTCATGTCGACTGTCTGACCGCCGACTTCACAACACGT
CCACCGTGCAAAACATGTCTTTCGACACTTACTCCCGATGGCAAAAAAAACATTCGACGGAATACTGGTGCAGTG
GTTAGAACGAAAGCAAAAGATGGTCGCTCGGTGTATGTGATTTTTTTCTGGAAGTCTAGCTCTAGCGCTATGTTA
GAGGGACCTTGATATAGATCGTGTTTATGGTCTCTTCCAGGACCGTTGTTATCGATGCCGGCAAGACTTTTCAGG
CTGCGGCAGTCGAGTGGTTCCCCAAATTTGGTCTGCGAAGGATCGATGCTCTATTGATAACTCATGCTCATGCCG
ACGGTAAGCACTCGGCCGAGTATATTATACATGTTTTCGTTAAATCGCGTTTTCGGGTCAGCTATTAATGGACTT
GATGACCTCAGAGGTGTGTGGAATTATCGTATTATCCCTTCCTAAATGAATGCTGATTTACATCAGGCTGGACCT
TGAACAAAGCAATTCAATCCCATATTGATGTCTACTTGTCGCAAGAAACGTTTATTGAGCTACAGAGATCGTTTC
CGTACCTCATATCCAAAGAATTCGCGTCGGGCGGAGGAGATGTACGTTGTTCTTCGAATTATGGGAACACCAACT
TGACAGATAATCAAGGTCCCAGCCTTCCGGTATCACATCATCAATGATGGTGAGCCATTCGAGATAGAGGACACT
GGTATCAATGTCACGCCTTTTGCTGGTCAGATTTCTAGTCATAGGTTGACAAGGTGCTGAGATAACTCACGGACT
TTTCGTGTAGTTCATCACGGGCGCATCTTCTCAAGACTGCCACCTGCAGGTTATGTTATCACTCCGACTGCGACT
CTACCATCTACACCAAACAAGTCGGATATCAGAGCACTTTCTCCGGAGCCGGGGGAACAGAAGTTCGGAGAGTGT
GTGGCAAAGGAGCAACCTGAAGCGACTATACACCCCTTACTGTGCTTTGGATTCAAGATTCAAGAGCAGTTGGTG
TACATCTCGGATGTCTCCCATATACCAGATCATGTTTGGGGCACGTTGCAGAGTAAACGGGGGGATAGTGCACAA
CAATTGCCAGTTCTAGTGCTGGATTGTCTGCGTCTGCGTCCCTTTATCTCACACCTCGGAATTGCAGATGCATTG
ATGATCGCGAAGAAGATTGGGGCGACGAAGACTTACTTGACTGGTTTCAGCCATGAGGTCACTCACGAAGAATAC
GTGACGATCACCGAAGCTATTGGTGGGAAGTTGAAGAATAAAAACGATTTGACCGAGTCGGAAAAGACTGGCCTC
GAACTCGTTCAGGGCGGAGGGCAAATCTGGGTTAGACCAGCGCATGATGGGCTCAGACTGATCATAAACAAAGAT
GGTAGTGTGTACGATGAAAGCTATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail