Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|561400
Gene name
Locationscaffold_01a:1941975..1943037
Strand+
Gene length (bp)1062
Transcript length (bp)783
Coding sequence length (bp)783
Protein length (aa) 261

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 3.0E-33 8 199
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 2.8E-14 14 209
PF08659 KR KR domain 1.6E-05 10 93
PF01370 Epimerase NAD dependent epimerase/dehydratase family 7.0E-05 10 175

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P39577|DLTE_BACSU Uncharacterized oxidoreductase DltE OS=Bacillus subtilis (strain 168) GN=dltE PE=3 SV=2 7 234 6.0E-35
sp|Q9P7B4|YI13_SCHPO NADP-dependent 3-hydroxy acid dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC521.03 PE=1 SV=1 6 212 1.0E-17
sp|P25970|Y5909_MYXXD Uncharacterized oxidoreductase MXAN_5909 OS=Myxococcus xanthus (strain DK 1622) GN=MXAN_5909 PE=3 SV=2 8 231 6.0E-17
sp|Q8T197|DHRS7_DICDI Dehydrogenase/reductase SDR family protein 7-like OS=Dictyostelium discoideum GN=DDB_G0274201 PE=3 SV=1 6 203 6.0E-15
sp|P39831|YDFG_ECOLI NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Escherichia coli (strain K12) GN=ydfG PE=1 SV=2 10 191 7.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P39577|DLTE_BACSU Uncharacterized oxidoreductase DltE OS=Bacillus subtilis (strain 168) GN=dltE PE=3 SV=2 7 234 6.0E-35
sp|Q9P7B4|YI13_SCHPO NADP-dependent 3-hydroxy acid dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC521.03 PE=1 SV=1 6 212 1.0E-17
sp|P25970|Y5909_MYXXD Uncharacterized oxidoreductase MXAN_5909 OS=Myxococcus xanthus (strain DK 1622) GN=MXAN_5909 PE=3 SV=2 8 231 6.0E-17
sp|Q8T197|DHRS7_DICDI Dehydrogenase/reductase SDR family protein 7-like OS=Dictyostelium discoideum GN=DDB_G0274201 PE=3 SV=1 6 203 6.0E-15
sp|P39831|YDFG_ECOLI NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Escherichia coli (strain K12) GN=ydfG PE=1 SV=2 10 191 7.0E-15
sp|Q8FHD2|YDFG_ECOL6 NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ydfG PE=3 SV=2 10 191 9.0E-15
sp|Q8X505|YDFG_ECO57 NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Escherichia coli O157:H7 GN=ydfG PE=3 SV=1 10 191 1.0E-14
sp|Q83RE8|YDFG_SHIFL NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Shigella flexneri GN=ydfG PE=3 SV=2 10 191 1.0E-14
sp|P69936|YDFG_SALTY NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ydfG PE=3 SV=1 10 191 6.0E-14
sp|P69935|YDFG_SALTI NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Salmonella typhi GN=ydfG PE=3 SV=1 10 191 6.0E-14
sp|Q4A054|Y0419_STAS1 Uncharacterized oxidoreductase SSP0419 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP0419 PE=3 SV=1 6 198 9.0E-14
sp|Q8MJY8|PGDH_MACFA 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Macaca fascicularis GN=HPGD PE=2 SV=1 6 195 2.0E-13
sp|Q05016|YM71_YEAST NADP-dependent 3-hydroxy acid dehydrogenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR226C PE=1 SV=1 8 195 2.0E-13
sp|Q9CXR1|DHRS7_MOUSE Dehydrogenase/reductase SDR family member 7 OS=Mus musculus GN=Dhrs7 PE=1 SV=2 10 207 2.0E-13
sp|P15428|PGDH_HUMAN 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Homo sapiens GN=HPGD PE=1 SV=1 6 195 2.0E-13
sp|Q9KWN1|SDH_RHIRD Serine 3-dehydrogenase OS=Rhizobium radiobacter GN=sdh PE=1 SV=1 7 195 4.0E-13
sp|Q5HLD8|Y2049_STAEQ Uncharacterized oxidoreductase SERP2049 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP2049 PE=3 SV=1 1 205 4.0E-13
sp|Q8CN40|Y2036_STAES Uncharacterized oxidoreductase SE_2036 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_2036 PE=3 SV=1 1 205 4.0E-13
sp|Q09851|AYR1_SCHPO NADPH-dependent 1-acyldihydroxyacetone phosphate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ayr1 PE=3 SV=2 4 196 6.0E-13
sp|Q9Y140|DHRS7_DROME Dehydrogenase/reductase SDR family protein 7-like OS=Drosophila melanogaster GN=CG7601 PE=2 SV=1 1 231 6.0E-13
sp|P70684|PGDH_CAVPO 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Cavia porcellus GN=HPGD PE=2 SV=1 6 195 6.0E-13
sp|Q9Y394|DHRS7_HUMAN Dehydrogenase/reductase SDR family member 7 OS=Homo sapiens GN=DHRS7 PE=1 SV=1 10 199 7.0E-13
sp|Q9X248|FABG_THEMA 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=fabG PE=3 SV=1 6 197 1.0E-12
sp|Q7Q732|DHRS7_ANOGA Dehydrogenase/reductase SDR family protein 7-like OS=Anopheles gambiae GN=AGAP005532 PE=3 SV=3 6 201 2.0E-12
sp|Q8U8I2|SDH_AGRFC Serine 3-dehydrogenase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=sdh PE=3 SV=1 7 195 2.0E-12
sp|Q99J47|DRS7B_MOUSE Dehydrogenase/reductase SDR family member 7B OS=Mus musculus GN=Dhrs7b PE=1 SV=1 10 203 3.0E-12
sp|Q3T0C2|PGDH_BOVIN 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Bos taurus GN=HPGD PE=2 SV=1 6 193 3.0E-12
sp|Q8KWT4|BACC_BACIU Dihydroanticapsin 7-dehydrogenase OS=Bacillus subtilis GN=bacC PE=1 SV=1 8 207 2.0E-11
sp|Q8VCC1|PGDH_MOUSE 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Mus musculus GN=Hpgd PE=1 SV=1 6 193 2.0E-11
sp|P55434|Y4EK_RHISN Uncharacterized short-chain type dehydrogenase/reductase y4eK OS=Rhizobium sp. (strain NGR234) GN=NGR_a03840 PE=3 SV=1 11 199 3.0E-11
sp|Q9STY8|HSD2_ARATH 11-beta-hydroxysteroid dehydrogenase-like 2 OS=Arabidopsis thaliana GN=HSD2 PE=2 SV=1 8 195 4.0E-11
sp|Q1QU27|ISFD2_CHRSD Sulfoacetaldehyde reductase 2 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=isfD2 PE=1 SV=1 7 212 7.0E-11
sp|P0A0I0|FABG_STAAW 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MW2) GN=fabG PE=3 SV=1 7 197 7.0E-11
sp|Q6G9Y2|FABG_STAAS 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MSSA476) GN=fabG PE=3 SV=1 7 197 7.0E-11
sp|Q6GHK4|FABG_STAAR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MRSA252) GN=fabG PE=3 SV=1 7 197 7.0E-11
sp|P99093|FABG_STAAN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain N315) GN=fabG PE=1 SV=1 7 197 7.0E-11
sp|P0A0H9|FABG_STAAM 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabG PE=1 SV=1 7 197 7.0E-11
sp|Q5HGK2|FABG_STAAC 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain COL) GN=fabG PE=3 SV=2 7 197 7.0E-11
sp|Q82IY9|PTLF_STRAW 1-deoxy-11-beta-hydroxypentalenate dehydrogenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ptlF PE=1 SV=1 11 195 1.0E-10
sp|Q9STY7|HSD3_ARATH 11-beta-hydroxysteroid dehydrogenase-like 3 OS=Arabidopsis thaliana GN=HSD3 PE=3 SV=1 8 195 2.0E-10
sp|O14351|YB45_SCHPO Uncharacterized oxidoreductase C30D10.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC30D10.05c PE=3 SV=1 8 172 3.0E-10
sp|Q1R183|ISFD_CHRSD Sulfoacetaldehyde reductase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=isfD PE=1 SV=1 7 195 4.0E-10
sp|Q4R5G7|DHB12_MACFA Very-long-chain 3-oxoacyl-CoA reductase OS=Macaca fascicularis GN=HSD17B12 PE=2 SV=1 2 195 4.0E-10
sp|A7TMJ2|MKAR_VANPO Very-long-chain 3-oxoacyl-CoA reductase OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_513p6 PE=3 SV=1 3 195 4.0E-10
sp|P00335|RIDH_ENTAE Ribitol 2-dehydrogenase OS=Enterobacter aerogenes GN=rbtD PE=1 SV=1 7 198 5.0E-10
sp|P45200|Y1430_HAEIN Probable NADP-dependent dehydrogenase HI_1430 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1430 PE=3 SV=1 11 191 6.0E-10
sp|P0A9P9|IDNO_ECOLI Gluconate 5-dehydrogenase OS=Escherichia coli (strain K12) GN=idnO PE=3 SV=1 7 195 6.0E-10
sp|P0A9Q0|IDNO_ECOL6 Gluconate 5-dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=idnO PE=3 SV=1 7 195 6.0E-10
sp|P39640|BACC_BACSU Dihydroanticapsin 7-dehydrogenase OS=Bacillus subtilis (strain 168) GN=bacC PE=1 SV=2 8 207 7.0E-10
sp|P25145|Y432_LISMO Uncharacterized oxidoreductase Lmo0432 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo0432 PE=3 SV=2 6 210 8.0E-10
sp|P50941|FABG_RICPR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Rickettsia prowazekii (strain Madrid E) GN=fabG PE=1 SV=2 11 197 1.0E-09
sp|P40580|BZRD_YEAST Benzil reductase ((S)-benzoin forming) IRC24 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRC24 PE=1 SV=1 8 198 1.0E-09
sp|Q9LUF2|HSD4B_ARATH 11-beta-hydroxysteroid dehydrogenase-like 4B OS=Arabidopsis thaliana GN=HSD7 PE=2 SV=2 3 193 1.0E-09
sp|P0DKC7|HSD4A_ARATH 11-beta-hydroxysteroid dehydrogenase-like 4A OS=Arabidopsis thaliana GN=HSD4 PE=2 SV=1 3 193 1.0E-09
sp|Q5RJY4|DRS7B_RAT Dehydrogenase/reductase SDR family member 7B OS=Rattus norvegicus GN=Dhrs7b PE=1 SV=1 10 203 1.0E-09
sp|P50162|TRN1_DATST Tropinone reductase 1 OS=Datura stramonium GN=TR1 PE=1 SV=1 11 198 2.0E-09
sp|Q68VY7|FABG_RICTY 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=fabG PE=3 SV=1 11 197 2.0E-09
sp|D3U1D9|ISFD_KLEOX Sulfoacetaldehyde reductase OS=Klebsiella oxytoca GN=isfD PE=1 SV=1 7 212 2.0E-09
sp|P37079|SORD_KLEPN Sorbitol-6-phosphate 2-dehydrogenase OS=Klebsiella pneumoniae GN=sorD PE=3 SV=1 10 192 2.0E-09
sp|P50202|MAS1_AGRT9 Agropine synthesis reductase OS=Agrobacterium tumefaciens (strain 15955) GN=mas1 PE=3 SV=1 6 195 2.0E-09
sp|P46331|YXBG_BACSU Uncharacterized oxidoreductase YxbG OS=Bacillus subtilis (strain 168) GN=yxbG PE=3 SV=2 6 204 3.0E-09
sp|O05730|VDLC_HELPY Probable short-chain type dehydrogenase/reductase VdlC OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=vdlC PE=3 SV=2 5 205 3.0E-09
sp|Q8CPI3|FABG_STAES 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus epidermidis (strain ATCC 12228) GN=fabG PE=3 SV=1 7 197 4.0E-09
sp|Q5HPW0|FABG_STAEQ 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=fabG PE=3 SV=1 7 197 4.0E-09
sp|Q9LUE4|HSD6_ARATH 11-beta-hydroxysteroid dehydrogenase-like 6 OS=Arabidopsis thaliana GN=HSD6 PE=2 SV=1 8 195 4.0E-09
sp|P50198|LINX_SPHPI 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase OS=Sphingomonas paucimobilis GN=linX PE=3 SV=1 7 188 4.0E-09
sp|P51831|FABG_BACSU 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Bacillus subtilis (strain 168) GN=fabG PE=3 SV=3 8 207 6.0E-09
sp|Q00791|STCU_EMENI Versicolorin reductase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcU PE=3 SV=2 6 195 7.0E-09
sp|Q92EK7|Y452_LISIN Uncharacterized oxidoreductase Lin0452 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lin0452 PE=3 SV=1 6 210 7.0E-09
sp|P22414|FOX2_CANTR Peroxisomal hydratase-dehydrogenase-epimerase OS=Candida tropicalis PE=1 SV=2 6 195 9.0E-09
sp|P40579|YIV5_YEAST Uncharacterized oxidoreductase YIR035C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIR035C PE=1 SV=1 8 196 1.0E-08
sp|P16542|DHK1_STRVN Granaticin polyketide synthase putative ketoacyl reductase 1 OS=Streptomyces violaceoruber GN=gra-orf5 PE=3 SV=1 11 217 1.0E-08
sp|P41177|DHKR_STRCM Monensin polyketide synthase putative ketoacyl reductase OS=Streptomyces cinnamonensis PE=3 SV=1 7 195 1.0E-08
sp|Q0IH28|DRS7B_XENLA Dehydrogenase/reductase SDR family member 7B OS=Xenopus laevis GN=dhrs7b PE=2 SV=1 6 203 2.0E-08
sp|O32229|YVAG_BACSU Uncharacterized oxidoreductase YvaG OS=Bacillus subtilis (strain 168) GN=yvaG PE=3 SV=1 6 188 2.0E-08
sp|G5DGA8|IDLDH_IPSPI Ipsdienol dehydrogenase OS=Ips pini GN=IDOLDH PE=1 SV=1 11 199 2.0E-08
sp|P76633|YGCW_ECOLI Uncharacterized oxidoreductase YgcW OS=Escherichia coli (strain K12) GN=ygcW PE=3 SV=2 6 195 3.0E-08
sp|Q93X68|FABG5_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 5, chloroplastic (Fragment) OS=Brassica napus GN=bkr1 PE=2 SV=1 6 215 3.0E-08
sp|P0DKC6|HSD1B_ARATH 11-beta-hydroxysteroid dehydrogenase 1B OS=Arabidopsis thaliana GN=HSD1 PE=1 SV=1 8 195 3.0E-08
sp|P0DKC5|HSD1A_ARATH 11-beta-hydroxysteroid dehydrogenase 1A OS=Arabidopsis thaliana GN=HSD1 PE=1 SV=1 8 195 3.0E-08
sp|P16544|ACT3_STRCO Putative ketoacyl reductase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=actIII PE=1 SV=1 5 209 4.0E-08
sp|P28643|FABG_CUPLA 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic OS=Cuphea lanceolata GN=CLKR27 PE=2 SV=1 6 215 5.0E-08
sp|Q949M2|FABG4_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 4 (Fragment) OS=Brassica napus GN=bkr4 PE=2 SV=1 6 195 5.0E-08
sp|Q9FZ42|GRDH1_ARATH Glucose and ribitol dehydrogenase homolog 1 OS=Arabidopsis thaliana GN=At1g54870 PE=2 SV=1 8 198 6.0E-08
sp|Q5XG41|DH12A_XENLA Very-long-chain 3-oxoacyl-CoA reductase-A OS=Xenopus laevis GN=hsd17b12-a PE=2 SV=1 7 195 7.0E-08
sp|P9WGR7|Y945_MYCTU Uncharacterized oxidoreductase Rv0945 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0945 PE=1 SV=1 1 202 7.0E-08
sp|P9WGR6|Y945_MYCTO Uncharacterized oxidoreductase MT0971 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0971 PE=3 SV=1 1 202 7.0E-08
sp|Q8VID1|DHRS4_RAT Dehydrogenase/reductase SDR family member 4 OS=Rattus norvegicus GN=Dhrs4 PE=2 SV=2 7 226 8.0E-08
sp|Q0VFE7|DRS7B_XENTR Dehydrogenase/reductase SDR family member 7B OS=Xenopus tropicalis GN=dhrs7b PE=2 SV=1 6 203 9.0E-08
sp|Q6P7J1|DHI1A_XENLA Hydroxysteroid 11-beta-dehydrogenase 1-like protein A OS=Xenopus laevis GN=hsd11b1l-a PE=2 SV=1 8 194 1.0E-07
sp|P51658|DHB2_MOUSE Estradiol 17-beta-dehydrogenase 2 OS=Mus musculus GN=Hsd17b2 PE=1 SV=2 6 207 1.0E-07
sp|Q28IU1|DHB12_XENTR Very-long-chain 3-oxoacyl-CoA reductase OS=Xenopus tropicalis GN=hsd17b12 PE=2 SV=1 7 195 1.0E-07
sp|Q99LB2|DHRS4_MOUSE Dehydrogenase/reductase SDR family member 4 OS=Mus musculus GN=Dhrs4 PE=1 SV=3 7 195 1.0E-07
sp|Q6P3L6|DH12A_DANRE Very-long-chain 3-oxoacyl-CoA reductase-A OS=Danio rerio GN=hsd17b12a PE=2 SV=1 8 195 2.0E-07
sp|Q9R092|H17B6_MOUSE 17-beta-hydroxysteroid dehydrogenase type 6 OS=Mus musculus GN=Hsd17b6 PE=1 SV=1 6 234 2.0E-07
sp|P33207|FABG_ARATH 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic OS=Arabidopsis thaliana GN=At1g24360 PE=1 SV=2 6 215 2.0E-07
sp|P50200|HDHA_CLOSO NADP-dependent 7-alpha-hydroxysteroid dehydrogenase OS=Clostridium sordellii PE=1 SV=1 6 194 2.0E-07
sp|O57314|DHB12_ANAPL Very-long-chain 3-oxoacyl-CoA reductase OS=Anas platyrhynchos GN=HSD17B12 PE=2 SV=1 11 195 3.0E-07
sp|O74628|YQ53_SCHPO Uncharacterized oxidoreductase C162.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC162.03 PE=3 SV=1 10 194 3.0E-07
sp|Q8KES3|SPRE_CHLTE Sepiapterin reductase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=CT0609 PE=1 SV=1 10 191 5.0E-07
sp|Q8NUV9|Y2403_STAAW Uncharacterized oxidoreductase MW2403 OS=Staphylococcus aureus (strain MW2) GN=MW2403 PE=3 SV=1 8 195 5.0E-07
sp|Q6G6J1|Y2370_STAAS Uncharacterized oxidoreductase SAS2370 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2370 PE=3 SV=1 8 195 5.0E-07
sp|Q29608|DHI1_SAISC Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Saimiri sciureus GN=HSD11B1 PE=2 SV=3 2 194 6.0E-07
sp|Q566S6|DRS7B_DANRE Dehydrogenase/reductase SDR family member 7B OS=Danio rerio GN=dhrs7b PE=2 SV=1 2 203 6.0E-07
sp|Q6GDV6|Y2567_STAAR Uncharacterized oxidoreductase SAR2567 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2567 PE=3 SV=1 8 204 6.0E-07
sp|O32291|YXNA_BACSU Uncharacterized oxidoreductase YxnA OS=Bacillus subtilis (strain 168) GN=yxnA PE=3 SV=2 8 199 6.0E-07
sp|O54753|H17B6_RAT 17-beta-hydroxysteroid dehydrogenase type 6 OS=Rattus norvegicus GN=Hsd17b6 PE=1 SV=2 8 216 7.0E-07
sp|Q2FVD5|Y2778_STAA8 Uncharacterized oxidoreductase SAOUHSC_02778 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02778 PE=3 SV=1 8 204 7.0E-07
sp|Q5HD73|Y2488_STAAC Uncharacterized oxidoreductase SACOL2488 OS=Staphylococcus aureus (strain COL) GN=SACOL2488 PE=3 SV=1 8 204 7.0E-07
sp|Q2FE21|Y2422_STAA3 Uncharacterized oxidoreductase SAUSA300_2422 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_2422 PE=3 SV=1 8 204 7.0E-07
sp|Q9ZKW1|VDLC_HELPJ Probable short-chain type dehydrogenase/reductase VdlC OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=vdlC PE=3 SV=1 11 204 7.0E-07
sp|Q21929|DCXR_CAEEL L-xylulose reductase OS=Caenorhabditis elegans GN=dhs-21 PE=1 SV=2 8 218 8.0E-07
sp|Q949M3|FABG3_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 3, chloroplastic OS=Brassica napus GN=bkr3 PE=2 SV=1 6 215 8.0E-07
sp|Q93X62|FABG1_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 1, chloroplastic OS=Brassica napus GN=gbkr1 PE=1 SV=1 6 215 9.0E-07
sp|Q5E9H7|DHB12_BOVIN Very-long-chain 3-oxoacyl-CoA reductase OS=Bos taurus GN=HSD17B12 PE=2 SV=1 11 195 1.0E-06
sp|Q9SY73|PTALR_ARATH NADPH-dependent pterin aldehyde reductase OS=Arabidopsis thaliana GN=At1g10310 PE=1 SV=1 4 195 1.0E-06
sp|Q9Z8P2|FABG_CHLPN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia pneumoniae GN=fabG PE=3 SV=1 8 195 1.0E-06
sp|O31767|YMFI_BACSU Uncharacterized oxidoreductase YmfI OS=Bacillus subtilis (strain 168) GN=ymfI PE=3 SV=2 7 197 1.0E-06
sp|A5PJF6|HSDL1_BOVIN Inactive hydroxysteroid dehydrogenase-like protein 1 OS=Bos taurus GN=HSDL1 PE=2 SV=1 11 195 1.0E-06
sp|O07575|YHDF_BACSU Uncharacterized oxidoreductase YhdF OS=Bacillus subtilis (strain 168) GN=yhdF PE=3 SV=1 6 188 1.0E-06
sp|Q99RF5|Y2478_STAAM Uncharacterized oxidoreductase SAV2478 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2478 PE=3 SV=1 8 195 1.0E-06
sp|Q7A3L9|Y2266_STAAN Uncharacterized oxidoreductase SA2266 OS=Staphylococcus aureus (strain N315) GN=SA2266 PE=1 SV=1 8 195 1.0E-06
sp|P55336|FABG_VIBHA 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Vibrio harveyi GN=fabG PE=3 SV=1 6 198 2.0E-06
sp|O08699|PGDH_RAT 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Rattus norvegicus GN=Hpgd PE=2 SV=2 6 193 2.0E-06
sp|Q93X67|FABG2_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 2, chloroplastic OS=Brassica napus GN=bkr2 PE=2 SV=1 6 215 2.0E-06
sp|P07772|BEND_ACIAD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=benD PE=3 SV=2 6 222 2.0E-06
sp|Q73SC8|Y4146_MYCPA Uncharacterized NAD-dependent oxidoreductase MAP_4146 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=MAP_4146 PE=1 SV=1 6 194 2.0E-06
sp|Q01373|FOX2_NEUCR Peroxisomal hydratase-dehydrogenase-epimerase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fox-2 PE=1 SV=1 6 211 2.0E-06
sp|P37694|HETN_NOSS1 Ketoacyl reductase HetN OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hetN PE=3 SV=2 8 192 2.0E-06
sp|Q62730|DHB2_RAT Estradiol 17-beta-dehydrogenase 2 OS=Rattus norvegicus GN=Hsd17b2 PE=2 SV=1 6 207 2.0E-06
sp|P38004|FABG_CHLTR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=fabG PE=3 SV=3 1 210 2.0E-06
sp|A6ZLA1|MKAR_YEAS7 Very-long-chain 3-oxoacyl-CoA reductase OS=Saccharomyces cerevisiae (strain YJM789) GN=SCY_0371 PE=3 SV=1 3 195 3.0E-06
sp|B3LN00|MKAR_YEAS1 Very-long-chain 3-oxoacyl-CoA reductase OS=Saccharomyces cerevisiae (strain RM11-1a) GN=SCRG_02811 PE=3 SV=1 3 195 3.0E-06
sp|A0R518|Y6031_MYCS2 Putative short-chain type dehydrogenase/reductase MSMEG_6031/MSMEI_5872 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=MSMEG_6031 PE=1 SV=1 1 211 3.0E-06
sp|P0AFP4|YBBO_ECOLI Uncharacterized oxidoreductase YbbO OS=Escherichia coli (strain K12) GN=ybbO PE=3 SV=1 8 203 3.0E-06
sp|P0AFP5|YBBO_ECOL6 Uncharacterized oxidoreductase YbbO OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ybbO PE=3 SV=1 8 203 3.0E-06
sp|Q5KTS5|GRDH_DAUCA Glucose and ribitol dehydrogenase OS=Daucus carota GN=CAISE5 PE=2 SV=1 6 198 4.0E-06
sp|O67610|FABG_AQUAE 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Aquifex aeolicus (strain VF5) GN=fabG PE=1 SV=1 6 195 5.0E-06
sp|O32099|BZRD_BACSU Benzil reductase ((S)-benzoin forming) OS=Bacillus subtilis (strain 168) GN=yueD PE=3 SV=1 11 255 5.0E-06
sp|G5EGA6|DHRS4_CAEEL Dehydrogenase/reductase SDR family member 4 OS=Caenorhabditis elegans GN=dhrs-4 PE=1 SV=1 6 195 5.0E-06
sp|Q6R0J2|DHI1_MESAU Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Mesocricetus auratus GN=HSD11B1 PE=1 SV=3 2 183 5.0E-06
sp|E3VWK2|PENF_STREX 1-deoxy-11-beta-hydroxypentalenate dehydrogenase OS=Streptomyces exfoliatus GN=penF PE=3 SV=1 6 195 6.0E-06
sp|Q8K3P0|DR9C7_MOUSE Short-chain dehydrogenase/reductase family 9C member 7 OS=Mus musculus GN=Sdr9c7 PE=2 SV=1 8 209 7.0E-06
sp|Q8NEX9|DR9C7_HUMAN Short-chain dehydrogenase/reductase family 9C member 7 OS=Homo sapiens GN=SDR9C7 PE=1 SV=1 8 209 7.0E-06
sp|Q9N126|RDH8_BOVIN Retinol dehydrogenase 8 OS=Bos taurus GN=RDH8 PE=1 SV=1 8 195 9.0E-06
sp|Q3T046|BDH2_BOVIN 3-hydroxybutyrate dehydrogenase type 2 OS=Bos taurus GN=BDH2 PE=2 SV=1 6 193 9.0E-06
sp|Q8JZV9|BDH2_MOUSE 3-hydroxybutyrate dehydrogenase type 2 OS=Mus musculus GN=Bdh2 PE=1 SV=1 6 193 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|561400
MPGIEESKCILVTGATAGIGRVLALSLAKLPSKPQVIAAGRRQSRLDELRKEGLETLQLDLDTDALTLKKSVDSI
LDKYPQLDAVILNAGVQYEFDFKKEVDVNKLLSEVNINYTAVVTMITYLTPHFLKLSESGRPSFIIPVTAGLGIV
PAVWTPGYSASKAAIHSFTTSLRVQLNDTNVRVLEIIPPLVESELHDDAGTTDKLTKLWMPLDEYIDVTMQGLRN
GDTIISTGKSLSLYEKFDKEKDGTIALMKEAREKW*
Coding >Agabi119p4|561400
ATGCCTGGAATTGAAGAAAGCAAATGCATCCTAGTTACTGGTGCGACCGCAGGAATAGGTCGAGTCTTGGCTCTT
AGTTTAGCCAAGTTACCTTCCAAACCCCAAGTCATCGCCGCTGGGAGACGACAGAGTAGACTCGATGAACTTCGA
AAAGAAGGCTTAGAGACTCTCCAACTTGATTTGGACACTGATGCTCTTACGTTGAAAAAATCCGTCGATTCCATT
CTTGATAAATATCCCCAGCTCGACGCAGTCATTTTGAATGCTGGAGTACAATACGAATTTGACTTTAAAAAGGAG
GTGGACGTCAACAAATTGTTATCCGAAGTGAACATTAATTATACCGCCGTCGTAACAATGATTACCTACCTCACT
CCACATTTCTTGAAGCTTTCGGAATCGGGTCGTCCCTCGTTCATAATCCCTGTCACTGCTGGTTTGGGCATTGTC
CCTGCAGTATGGACTCCTGGTTATTCCGCTTCGAAAGCCGCCATTCACTCTTTCACTACGAGTTTGCGAGTACAA
TTAAATGATACCAATGTTCGCGTTCTGGAAATAATCCCACCACTTGTAGAATCGGAACTACATGATGACGCGGGC
ACTACGGACAAGCTCACCAAGTTATGGATGCCCCTCGATGAATACATCGACGTCACGATGCAAGGACTAAGGAAC
GGCGATACTATCATATCTACGGGGAAATCACTTAGCCTGTACGAAAAGTTTGACAAAGAAAAGGATGGTACAATA
GCATTGATGAAAGAAGCAAGGGAGAAATGGTGA
Transcript >Agabi119p4|561400
ATGCCTGGAATTGAAGAAAGCAAATGCATCCTAGTTACTGGTGCGACCGCAGGAATAGGTCGAGTCTTGGCTCTT
AGTTTAGCCAAGTTACCTTCCAAACCCCAAGTCATCGCCGCTGGGAGACGACAGAGTAGACTCGATGAACTTCGA
AAAGAAGGCTTAGAGACTCTCCAACTTGATTTGGACACTGATGCTCTTACGTTGAAAAAATCCGTCGATTCCATT
CTTGATAAATATCCCCAGCTCGACGCAGTCATTTTGAATGCTGGAGTACAATACGAATTTGACTTTAAAAAGGAG
GTGGACGTCAACAAATTGTTATCCGAAGTGAACATTAATTATACCGCCGTCGTAACAATGATTACCTACCTCACT
CCACATTTCTTGAAGCTTTCGGAATCGGGTCGTCCCTCGTTCATAATCCCTGTCACTGCTGGTTTGGGCATTGTC
CCTGCAGTATGGACTCCTGGTTATTCCGCTTCGAAAGCCGCCATTCACTCTTTCACTACGAGTTTGCGAGTACAA
TTAAATGATACCAATGTTCGCGTTCTGGAAATAATCCCACCACTTGTAGAATCGGAACTACATGATGACGCGGGC
ACTACGGACAAGCTCACCAAGTTATGGATGCCCCTCGATGAATACATCGACGTCACGATGCAAGGACTAAGGAAC
GGCGATACTATCATATCTACGGGGAAATCACTTAGCCTGTACGAAAAGTTTGACAAAGAAAAGGATGGTACAATA
GCATTGATGAAAGAAGCAAGGGAGAAATGGTGA
Gene >Agabi119p4|561400
ATGCCTGGAATTGAAGAAAGCAAATGCATCCTAGTTACTGGTGCGACCGCAGGAATAGGTCGAGTCTTGGCTCTT
AGTTTAGCCAAGTTACCTTCCAAACCCCAAGTCATCGCCGCTGGGAGACGACAGAGTAGACTCGATGAACTTCGA
AAAGAAGGCTTAGAGACTCTCCAACTTGATTTGGACACTGATGCTCTTACGTTGAAAAAATCCGTCGATTCCATT
CTTGATAAATATCCCCAGGTGTGTCTTCTTACTTGGGTGATCAATTGGTCACTAATAACTGATTAACGTCATCCA
TTCAGCTCGACGCAGTCATTTTGAATGCTGGAGTACAATACGAATTTGACTTTAAAAAGGAGGTGGACGTCAACA
GTAAGTTAAATTTCGGACGTTATGACAATCTATCAGAACCAATCCAAACGTCATGTAGAATTGTTATCCGAAGTG
AACATTAATTATACCGCCGTCGTAACAATGATTACCTACCTCACTCCACATTTCTTGAAGCTTTCGGTATGTTGT
ACTCTGACAAGACAATTTGTTCTTGTGGCTTATTATTCAAAGGAATCGGGTCGTCCCTCGTTCATAATCCCTGTC
ACTGCTGGTTTGGGCATTGTCCCTGCAGTATGGACTCCTGGTTATTCCGCTTCGAAAGCCGCCATTCACTCTTTC
ACTACGAGTTTGCGAGTACAATTAAATGATACCAATGTTCGCGTTCTGGAAATAATCCCACCGTAAGCTCTTCAT
CAAGCATTCTCTACTGTGTACCTCCGCATGATGCACTATTTCAGACTTGTAGAATCGGAACTACATGATGGTCAG
TTATATTATACTAATTCTTTACTTCTGATTTATGATTTGTTGGCAGACGCGGGCACTACGGACAAGCTCACCAAG
TTATGGATGCCCCTCGATGAATACATCGACGTCACGATGCAAGGACTAAGGAACGGCGATACTATCATATCTACG
GGGAAATCACTTAGCCTGTACGAAAAGTTTGACAAAGAAAAGGATGGTACAATAGCATTGATGAAAGAAGCAAGG
GAGAAATGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail