Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|560150
Gene name
Locationscaffold_01a:1438936..1439693
Strand-
Gene length (bp)757
Transcript length (bp)696
Coding sequence length (bp)696
Protein length (aa) 232

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P04927|SANT_PLAFF S-antigen protein OS=Plasmodium falciparum (isolate FC27 / Papua New Guinea) PE=4 SV=1 63 212 1.0E-11
sp|P04927|SANT_PLAFF S-antigen protein OS=Plasmodium falciparum (isolate FC27 / Papua New Guinea) PE=4 SV=1 70 231 4.0E-11
sp|P04927|SANT_PLAFF S-antigen protein OS=Plasmodium falciparum (isolate FC27 / Papua New Guinea) PE=4 SV=1 49 190 3.0E-10
sp|A8YPR9|SVMI1_CERCE Snake venom metalloprotease inhibitor 02A10 OS=Cerastes cerastes GN=Svmpi-Cce12 PE=1 SV=1 55 216 4.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|560150
MRAFFIISALFLAFASQIMGAPVKMPMPLAREAKSIETFSAYVRRQGLSVEEPVSKRSDVPVERPSKSTNGVVEA
YDKRSDVPVERPSKSLNGVVEAYDKRSDVPVERPSKSLNGVVEAYDKRSDVPVERPSKSTNGVVEAYDKRSDVPV
ERPSKSLNGVVEAYDKRSDVPVERPSKSTNGVVEAYDKRSDVPVERPSKSLNGVVEAYDKRSDVPVERPSQSLQG
VVEPYN*
Coding >Agabi119p4|560150
ATGCGTGCCTTCTTCATCATCTCCGCGCTTTTCCTCGCTTTCGCTAGTCAGATCATGGGAGCTCCTGTTAAAATG
CCCATGCCCCTTGCACGCGAGGCAAAATCGATTGAAACTTTTAGCGCTTATGTCCGTCGCCAGGGCCTCTCAGTA
GAGGAGCCAGTCAGCAAGAGGAGCGATGTACCCGTCGAGCGACCATCCAAGTCCACCAACGGAGTCGTAGAAGCT
TATGATAAGAGGAGTGATGTGCCCGTCGAGCGGCCGTCCAAGTCCCTCAACGGAGTCGTCGAGGCGTATGACAAG
AGAAGCGATGTGCCCGTCGAGCGGCCTTCCAAGTCCCTCAACGGAGTCGTTGAGGCATATGACAAGAGAAGCGAT
GTGCCCGTCGAGCGACCATCCAAATCCACCAACGGAGTCGTAGAAGCTTATGACAAGAGAAGCGATGTACCTGTC
GAGCGGCCATCCAAGTCCCTCAACGGAGTCGTCGAGGCGTATGACAAGAGGAGTGACGTACCCGTCGAGCGGCCA
TCCAAGTCCACCAACGGAGTCGTAGAAGCCTACGACAAGAGAAGTGATGTACCCGTCGAGAGGCCGTCCAAGTCC
CTCAACGGAGTCGTCGAGGCATATGACAAGAGGAGCGATGTACCTGTTGAGCGGCCATCCCAATCCCTCCAGGGA
GTCGTTGAACCCTACAATTGA
Transcript >Agabi119p4|560150
ATGCGTGCCTTCTTCATCATCTCCGCGCTTTTCCTCGCTTTCGCTAGTCAGATCATGGGAGCTCCTGTTAAAATG
CCCATGCCCCTTGCACGCGAGGCAAAATCGATTGAAACTTTTAGCGCTTATGTCCGTCGCCAGGGCCTCTCAGTA
GAGGAGCCAGTCAGCAAGAGGAGCGATGTACCCGTCGAGCGACCATCCAAGTCCACCAACGGAGTCGTAGAAGCT
TATGATAAGAGGAGTGATGTGCCCGTCGAGCGGCCGTCCAAGTCCCTCAACGGAGTCGTCGAGGCGTATGACAAG
AGAAGCGATGTGCCCGTCGAGCGGCCTTCCAAGTCCCTCAACGGAGTCGTTGAGGCATATGACAAGAGAAGCGAT
GTGCCCGTCGAGCGACCATCCAAATCCACCAACGGAGTCGTAGAAGCTTATGACAAGAGAAGCGATGTACCTGTC
GAGCGGCCATCCAAGTCCCTCAACGGAGTCGTCGAGGCGTATGACAAGAGGAGTGACGTACCCGTCGAGCGGCCA
TCCAAGTCCACCAACGGAGTCGTAGAAGCCTACGACAAGAGAAGTGATGTACCCGTCGAGAGGCCGTCCAAGTCC
CTCAACGGAGTCGTCGAGGCATATGACAAGAGGAGCGATGTACCTGTTGAGCGGCCATCCCAATCCCTCCAGGGA
GTCGTTGAACCCTACAATTGA
Gene >Agabi119p4|560150
ATGCGTGCCTTCTTCATCATCTCCGCGCTTTTCCTCGCTTTCGCTAGTCAGATCATGGGAGCTCCTGTTAAAATG
CCCATGCCCCTTGCAGTCAGTCCTTTCATGCCTTGCTTCATTTTCCATCGCTTCTAACGCAGAGAATGGTCAACA
GCGCGAGGCAAAATCGATTGAAACTTTTAGCGCTTATGTCCGTCGCCAGGGCCTCTCAGTAGAGGAGCCAGTCAG
CAAGAGGAGCGATGTACCCGTCGAGCGACCATCCAAGTCCACCAACGGAGTCGTAGAAGCTTATGATAAGAGGAG
TGATGTGCCCGTCGAGCGGCCGTCCAAGTCCCTCAACGGAGTCGTCGAGGCGTATGACAAGAGAAGCGATGTGCC
CGTCGAGCGGCCTTCCAAGTCCCTCAACGGAGTCGTTGAGGCATATGACAAGAGAAGCGATGTGCCCGTCGAGCG
ACCATCCAAATCCACCAACGGAGTCGTAGAAGCTTATGACAAGAGAAGCGATGTACCTGTCGAGCGGCCATCCAA
GTCCCTCAACGGAGTCGTCGAGGCGTATGACAAGAGGAGTGACGTACCCGTCGAGCGGCCATCCAAGTCCACCAA
CGGAGTCGTAGAAGCCTACGACAAGAGAAGTGATGTACCCGTCGAGAGGCCGTCCAAGTCCCTCAACGGAGTCGT
CGAGGCATATGACAAGAGGAGCGATGTACCTGTTGAGCGGCCATCCCAATCCCTCCAGGGAGTCGTTGAACCCTA
CAATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail