Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|559550
Gene name
Locationscaffold_01a:1136848..1138850
Strand+
Gene length (bp)2002
Transcript length (bp)1227
Coding sequence length (bp)1227
Protein length (aa) 409

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00445 Ribonuclease_T2 Ribonuclease T2 family 1.1E-43 64 239

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P81296|RNL2_LENED Ribonuclease Le2 OS=Lentinula edodes PE=1 SV=1 35 270 6.0E-108
sp|P24657|RNTR_HYPRU Ribonuclease Trv OS=Hypocrea rufa PE=1 SV=1 36 270 9.0E-86
sp|Q5B3K6|RNY1_EMENI Ribonuclease T2-like OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rny1 PE=3 SV=1 46 393 5.0E-85
sp|Q4WXZ5|RNY1_ASPFU Ribonuclease T2-like OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rny1 PE=3 SV=2 18 387 2.0E-83
sp|P10281|RNT2_ASPOR Ribonuclease T2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rntB PE=1 SV=2 39 277 8.0E-79
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P81296|RNL2_LENED Ribonuclease Le2 OS=Lentinula edodes PE=1 SV=1 35 270 6.0E-108
sp|P24657|RNTR_HYPRU Ribonuclease Trv OS=Hypocrea rufa PE=1 SV=1 36 270 9.0E-86
sp|Q5B3K6|RNY1_EMENI Ribonuclease T2-like OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rny1 PE=3 SV=1 46 393 5.0E-85
sp|Q4WXZ5|RNY1_ASPFU Ribonuclease T2-like OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rny1 PE=3 SV=2 18 387 2.0E-83
sp|P10281|RNT2_ASPOR Ribonuclease T2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rntB PE=1 SV=2 39 277 8.0E-79
sp|P19791|RNM_ASPPH Ribonuclease M OS=Aspergillus phoenicis PE=1 SV=1 39 272 2.0E-75
sp|Q6CAV7|RNY1_YARLI Ribonuclease T2-like OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RNY1 PE=3 SV=1 39 398 9.0E-73
sp|Q5AK94|RNY1A_CANAL Ribonuclease T2-like 1-A OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RNY1-A PE=3 SV=1 31 358 4.0E-71
sp|Q5AKB1|RNY1B_CANAL Ribonuclease T2-like 1-B OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RNY1-B PE=3 SV=1 44 367 5.0E-67
sp|Q6BHB1|RNY1_DEBHA Ribonuclease T2-like OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RNY1 PE=3 SV=2 39 380 5.0E-60
sp|Q6CRT6|RNY1_KLULA Ribonuclease T2-like OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RNY1 PE=3 SV=1 39 408 2.0E-55
sp|Q6FP42|RNY1_CANGA Ribonuclease T2-like OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RNY1 PE=3 SV=1 36 405 3.0E-51
sp|Q02933|RNY1_YEAST Ribonuclease T2-like OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RNY1 PE=1 SV=1 35 342 3.0E-47
sp|Q75BW5|RNY1_ASHGO Ribonuclease T2-like OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RNY1 PE=3 SV=1 39 271 5.0E-41
sp|P08056|RNRH_RHINI Ribonuclease Rh OS=Rhizopus niveus PE=1 SV=1 13 269 2.0E-35
sp|P42813|RNS1_ARATH Ribonuclease 1 OS=Arabidopsis thaliana GN=RNS1 PE=1 SV=1 76 228 2.0E-14
sp|O00584|RNT2_HUMAN Ribonuclease T2 OS=Homo sapiens GN=RNASET2 PE=1 SV=2 80 225 1.0E-13
sp|P80022|RNLE_SOLLC Extracellular ribonuclease LE OS=Solanum lycopersicum PE=1 SV=2 76 226 2.0E-13
sp|Q7M329|RNT2_PIG Ribonuclease T2 OS=Sus scrofa GN=RNASET2 PE=1 SV=1 80 225 2.0E-12
sp|P80196|RNLX_SOLLC Intracellular ribonuclease LX OS=Solanum lycopersicum GN=RNALX PE=1 SV=2 76 226 1.0E-11
sp|P42815|RNS3_ARATH Ribonuclease 3 OS=Arabidopsis thaliana GN=RNS3 PE=2 SV=1 76 267 1.0E-11
sp|Q9CQ01|RNT2_MOUSE Ribonuclease T2 OS=Mus musculus GN=Rnaset2 PE=1 SV=1 66 225 1.0E-11
sp|P81477|PHYB_PHYPO Ribonuclease Phyb OS=Physarum polycephalum PE=1 SV=1 82 233 2.0E-11
sp|P42814|RNS2_ARATH Ribonuclease 2 OS=Arabidopsis thaliana GN=RNS2 PE=2 SV=1 83 237 3.0E-10
sp|Q7M438|RNDI_DICDI Ribonuclease DdI OS=Dictyostelium discoideum GN=ddiA PE=1 SV=3 82 234 1.0E-09
sp|Q01796|RNS2_SOLTU Ribonuclease S-2 OS=Solanum tuberosum PE=2 SV=1 80 236 4.0E-09
sp|O80322|RNS1_PYRPY Ribonuclease S-1 OS=Pyrus pyrifolia PE=1 SV=1 76 229 3.0E-07
sp|Q40381|RNS7_NICAL Ribonuclease S-7 OS=Nicotiana alata PE=1 SV=1 65 234 6.0E-07
sp|P23540|RNMC_MOMCH Ribonuclease MC OS=Momordica charantia PE=1 SV=1 81 235 1.0E-06
sp|P83618|RN28_PANGI Ribonuclease-like storage protein OS=Panax ginseng PE=1 SV=2 81 228 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0033897 ribonuclease T2 activity Yes
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0016849 phosphorus-oxygen lyase activity No
GO:0004521 endoribonuclease activity No
GO:0003674 molecular_function No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0005488 binding No
GO:0016829 lyase activity No
GO:0097159 organic cyclic compound binding No
GO:0004540 ribonuclease activity No
GO:0003676 nucleic acid binding No
GO:0004518 nuclease activity No
GO:0003824 catalytic activity No
GO:0004519 endonuclease activity No
GO:1901363 heterocyclic compound binding No
GO:0016787 hydrolase activity No
GO:0140098 catalytic activity, acting on RNA No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|559550
MRSAIVLGVWVSVAAAIALQSPVGRTSLLDRSASISSGCSTSGPTSCHNTSPVSDTCCFESPGGLLLQTQFWDTD
PSTGPIDSWTIHGLWPDKCDGTFDQNCDPSRAYTGISSLLTSQGASDTLSFMNTHWVDINGQNERFWEHEWETHG
TCMSTLETSCLPSGSPRGAEAVAFFETVVRLFKTLPTYDWLSDAGITPSTSRTFSRSTLSSALENVAGVMPSLGC
NGNTLNAISWYFNLKGSIIDGEFIPINAIESGSCPSSGIRYPPKSGSGTPTSTSPPGPTGNPGSLPTKATIHAIH
SGSELGGLLSLGTWSTQTLATFTISGSADSFTMKSSKGDCGLSGGMFKCGSGVSSTTFSAKSSDGSLLLASGGST
SFSSDGIPSGTTVFDVYMGSSHGQQYTLEIIGS*
Coding >Agabi119p4|559550
ATGCGTAGCGCCATTGTTTTGGGTGTTTGGGTCTCTGTCGCAGCAGCTATTGCTCTGCAATCTCCCGTAGGAAGG
ACCAGTCTTCTTGACAGGAGCGCGAGCATTTCCTCTGGTTGTTCGACGAGTGGGCCTACTTCCTGCCATAACACT
TCACCGGTCTCGGACACTTGTTGTTTTGAAAGTCCAGGGGGTCTCTTGCTTCAAACCCAGTTTTGGGATACAGAT
CCGTCCACCGGGCCAATTGATAGCTGGACAATACATGGATTGTGGCCCGACAAGTGTGATGGAACCTTTGACCAG
AATTGCGATCCCTCGCGTGCTTACACGGGAATAAGTTCATTGTTGACTTCTCAGGGAGCGAGCGATACGTTGTCA
TTTATGAACACACATTGGGTTGATATTAACGGACAAAATGAACGATTCTGGGAGCATGAGTGGGAAACGCACGGA
ACTTGTATGAGCACTTTGGAGACTTCTTGTTTGCCAAGCGGAAGCCCGAGAGGTGCAGAGGCAGTTGCCTTCTTC
GAAACTGTTGTCAGACTATTCAAAACATTGCCAACCTACGACTGGCTGTCAGATGCAGGCATCACTCCCAGCACG
TCCAGAACCTTCAGTCGATCAACCTTGTCCTCGGCACTCGAAAATGTGGCAGGCGTAATGCCGTCATTGGGTTGT
AACGGAAATACACTAAACGCCATATCCTGGTATTTTAACTTGAAGGGTTCAATAATCGATGGCGAGTTCATTCCA
ATTAATGCTATCGAGAGCGGATCGTGCCCTTCGTCGGGTATCAGATATCCACCCAAGTCTGGTTCCGGAACCCCA
ACATCCACTTCTCCCCCAGGTCCGACAGGGAATCCAGGATCTCTCCCGACAAAGGCAACCATACATGCCATTCAT
TCGGGGTCTGAATTGGGCGGGCTTCTTTCCCTTGGGACGTGGTCAACACAGACCTTGGCGACTTTCACAATTTCC
GGATCAGCTGATAGCTTCACGATGAAATCATCTAAAGGGGACTGCGGCTTGAGTGGAGGTATGTTCAAGTGCGGG
AGTGGAGTGTCCTCGACCACCTTTTCTGCGAAATCGTCGGATGGGTCCTTACTTCTGGCATCTGGAGGCTCAACC
AGCTTTTCAAGCGACGGCATCCCGAGCGGAACAACGGTGTTTGACGTCTATATGGGGTCTTCGCACGGCCAACAG
TACACACTGGAGATCATTGGCTCTTGA
Transcript >Agabi119p4|559550
ATGCGTAGCGCCATTGTTTTGGGTGTTTGGGTCTCTGTCGCAGCAGCTATTGCTCTGCAATCTCCCGTAGGAAGG
ACCAGTCTTCTTGACAGGAGCGCGAGCATTTCCTCTGGTTGTTCGACGAGTGGGCCTACTTCCTGCCATAACACT
TCACCGGTCTCGGACACTTGTTGTTTTGAAAGTCCAGGGGGTCTCTTGCTTCAAACCCAGTTTTGGGATACAGAT
CCGTCCACCGGGCCAATTGATAGCTGGACAATACATGGATTGTGGCCCGACAAGTGTGATGGAACCTTTGACCAG
AATTGCGATCCCTCGCGTGCTTACACGGGAATAAGTTCATTGTTGACTTCTCAGGGAGCGAGCGATACGTTGTCA
TTTATGAACACACATTGGGTTGATATTAACGGACAAAATGAACGATTCTGGGAGCATGAGTGGGAAACGCACGGA
ACTTGTATGAGCACTTTGGAGACTTCTTGTTTGCCAAGCGGAAGCCCGAGAGGTGCAGAGGCAGTTGCCTTCTTC
GAAACTGTTGTCAGACTATTCAAAACATTGCCAACCTACGACTGGCTGTCAGATGCAGGCATCACTCCCAGCACG
TCCAGAACCTTCAGTCGATCAACCTTGTCCTCGGCACTCGAAAATGTGGCAGGCGTAATGCCGTCATTGGGTTGT
AACGGAAATACACTAAACGCCATATCCTGGTATTTTAACTTGAAGGGTTCAATAATCGATGGCGAGTTCATTCCA
ATTAATGCTATCGAGAGCGGATCGTGCCCTTCGTCGGGTATCAGATATCCACCCAAGTCTGGTTCCGGAACCCCA
ACATCCACTTCTCCCCCAGGTCCGACAGGGAATCCAGGATCTCTCCCGACAAAGGCAACCATACATGCCATTCAT
TCGGGGTCTGAATTGGGCGGGCTTCTTTCCCTTGGGACGTGGTCAACACAGACCTTGGCGACTTTCACAATTTCC
GGATCAGCTGATAGCTTCACGATGAAATCATCTAAAGGGGACTGCGGCTTGAGTGGAGGTATGTTCAAGTGCGGG
AGTGGAGTGTCCTCGACCACCTTTTCTGCGAAATCGTCGGATGGGTCCTTACTTCTGGCATCTGGAGGCTCAACC
AGCTTTTCAAGCGACGGCATCCCGAGCGGAACAACGGTGTTTGACGTCTATATGGGGTCTTCGCACGGCCAACAG
TACACACTGGAGATCATTGGCTCTTGA
Gene >Agabi119p4|559550
ATGCGTAGCGCCATTGTTTTGGGTGTTTGGGTCTCTGTCGCAGCAGCTATTGCTCTGCAATCTCCCGTAGGAAGG
ACCAGTCTTCTTGACAGGAGCGCGAGCATTTCCTCTGGTTGTTCGACGAGTGGGCCTACTTCCTGCCATAACACT
TCACCGGTCTCGGACACTTGTTGTTTTGAAAGTCCAGGGGTATGCATCTCCGAGTCGTCTTTGCCCTCAAATTAC
AAAAGGAATTAAAATCCGGTTTATTAGGGTCTCTTGCTTCAAACCCAGGTGCATTCATTAGTTTAAAATCTTTTT
AGATTCGTATAACTGAGGGAAGAAATTTGTGGGGGATAGTTTTGGGATACAGATCCGTCCACCGGGCCAATTGAT
AGCTGGACAATACATGGTGAGCCTAATTGATAGCCTCCACTATAGATTTTGTGACGTTATGCCAGGATTGTGGCC
CGACAAGTGAGGGTCGCTCTAAAAGGACATGGCGGAAGCACTCACATGTATACACATTTCTTAAGGTGTGATGGA
ACCTTTGACCAGAATTGCGATCCCTCGCGTGCTTACACGGGAATAAGTTCAGTAAGTACCATGTCGTCTGGCCTT
TCCAGGTTCAATCGGGTTAATCTTGTGCTGCTGTAGTTGTTGACTTCTCAGGGAGCGAGCGATACGTTGTCATTT
ATGAACACAGTGTGTCCCTATACCATCCTCCTTTTCTGAACCAGGATTCATTTTCTGTAGCATTGGGTTGATATT
AACGGACAAAATGAACGATTCTGGGAGGTCCGTCGTTTGATTGTAGTCACCGTAATGAAAAGCTGAATGGCAGAA
CAGCATGAGTGGGAAACGCACGGAACTTGTATGAGCACTTTGGAGACTTCTTGTTTGCCAAGCGGAAGCCCGAGA
GGTGCAGAGGTATGATTTACGTTCCTGGTATACCAACAAGTCACCATTGGAGATTTAGGCAGTTGCCTTCTTCGA
AACTGTTGTCAGACTATTCAAAGTCAGGTCACCAAAAGAGAAACTTTGGGATTGCATTCACTGACCTATACGCAG
ACATTGCCAACCTACGACTGGCTGTCAGATGCAGGCATCACTCCCAGCACGTCCAGAACCTTCAGTCGATCAACC
TTGTCCTCGGCACTCGAAAATGTGGCAGGCGTAATGCCGTCATTGGGTTGTAACGGAAATACACTAAACGCCATA
TCCTGGTATTTTAACTTGAAGGGTTCAATAATCGATGGCGAGTTCATTCCAATTAGTACGTTGACAATGGAATGA
AGAAGGTAGTATACTGAATCTTACCATAGATGCTATCGAGAGCGGATCGTGCCCTTCGTCGGGTATCAGATATCC
ACCCAAGTCTGGTTCCGGAACCCCAACATCCGTAAGTTCGAGACCTCAGTTGACGTGAAAAAAGACTCACCTACA
TGAATTAGACTTCTCCCGTAAGCTGAGTTGCACATAGGTCAATTGCGATTACTCACAAAAGAAATCCGGAACGAA
CAGCCAGGTCCGACAGGGGTGAGCGGGAAAAAACGCTGAATTGAAATGAGCAACTATTAACTGGAGGTTCTTCCA
GAATCCAGGATCTCTCCCGACAAAGGCAACCATACATGCCATTCATTCGGGGTCTGAATTGGGCGGGCTTCTTTC
CCTTGGGACGTGGTCAACACAGACCTTGGCGACTTTCACAATTTCCGGATCAGCTGATAGCTTCACGATGAAATC
ATCTAAAGGGGACTGCGGCTTGAGTGGAGGTATGTTCAAGTGCGGGAGTGGAGTGTCCTCGACCACCTTTTCTGC
GGTAAGTGTCAGTCTGACAGTTGTGAATTTAAATCGACGGGGTTATCCACCACAGAAATCGTCGGATGGGTCCTT
ACTTCTGGCATCTGGAGGCTCAACCAGCTTTTCAAGCGACGGCATCCCGAGCGGAACAACGGTGTTTGACGTCTA
TATGGGGTCTTCGCACGGCCAACAGTACACACTGGAGATCATTGGCTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail