Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|559150
Gene name
Locationscaffold_01a:992307..993150
Strand-
Gene length (bp)843
Transcript length (bp)690
Coding sequence length (bp)690
Protein length (aa) 230

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family 7.5E-12 6 195
PF00657 Lipase_GDSL GDSL-like Lipase/Acylhydrolase 5.0E-06 13 202

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q00017|RHA1_ASPAC Rhamnogalacturonan acetylesterase OS=Aspergillus aculeatus GN=rha1 PE=1 SV=1 18 215 7.0E-62
sp|Q5BAA2|RHA1_EMENI Rhamnogalacturonan acetylesterase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN2528 PE=1 SV=1 5 213 1.0E-61
sp|O31528|RHGT2_BACSU Probable rhamnogalacturonan acetylesterase YesY OS=Bacillus subtilis (strain 168) GN=yesY PE=1 SV=1 15 206 2.0E-17
sp|O31523|RHGT1_BACSU Rhamnogalacturonan acetylesterase RhgT OS=Bacillus subtilis (strain 168) GN=rhgT PE=1 SV=1 15 68 2.0E-07
sp|P42304|YXIM_BACSU Uncharacterized esterase YxiM OS=Bacillus subtilis (strain 168) GN=yxiM PE=1 SV=2 15 200 2.0E-07

GO

GO Term Description Terminal node
GO:0016788 hydrolase activity, acting on ester bonds Yes
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|559150
MARGGGGSAAPGTDGWGQYLGQYLTVPVVNRAIAGRSSRSYTDEGRFDALLNTVRPGDFVIIEFGHNDGMSGNVD
NGRQCAFGDGYNTTATVSNSAGQSLVIHTFPYYIQNAVVAIQAKGAIPIISSQTPSNDWSNGRIVAGPRFVGYAQ
TAANRTGATYVDHYAYVAQAYNKLGQTATTAFYPGDHTHTSPAGANVVAQAFMRGILCGNSSLKSKANSAGQSVP
NGCL*
Coding >Agabi119p4|559150
ATGGCCCGCGGTGGAGGAGGCTCTGCCGCACCTGGGACAGATGGCTGGGGACAGTACCTGGGACAGTATCTAACA
GTTCCTGTCGTCAATCGCGCTATTGCTGGCCGGTCTTCGAGATCATATACTGACGAGGGGCGCTTTGATGCTCTC
TTGAATACAGTGAGACCGGGTGACTTTGTAATTATCGAATTTGGCCATAACGATGGGATGTCTGGAAATGTCGAC
AATGGAAGGCAGTGTGCTTTCGGAGACGGGTATAACACTACTGCGACAGTGTCCAACTCTGCGGGACAATCCCTC
GTAATTCATACCTTCCCCTATTACATCCAGAATGCAGTTGTTGCAATCCAGGCCAAAGGCGCAATCCCTATAATT
TCTTCGCAAACCCCTAGCAATGACTGGTCCAATGGTCGCATAGTCGCAGGGCCTCGGTTTGTGGGATACGCACAA
ACTGCGGCAAATCGTACAGGCGCCACATATGTTGACCATTATGCTTATGTTGCACAAGCATACAACAAACTTGGA
CAGACCGCTACGACAGCTTTCTACCCGGGAGACCATACACACACATCACCTGCAGGCGCGAATGTGGTCGCGCAG
GCTTTCATGAGAGGGATACTGTGCGGAAATAGCTCGCTGAAATCGAAGGCCAACTCAGCTGGTCAGTCTGTCCCA
AATGGGTGTCTGTAG
Transcript >Agabi119p4|559150
ATGGCCCGCGGTGGAGGAGGCTCTGCCGCACCTGGGACAGATGGCTGGGGACAGTACCTGGGACAGTATCTAACA
GTTCCTGTCGTCAATCGCGCTATTGCTGGCCGGTCTTCGAGATCATATACTGACGAGGGGCGCTTTGATGCTCTC
TTGAATACAGTGAGACCGGGTGACTTTGTAATTATCGAATTTGGCCATAACGATGGGATGTCTGGAAATGTCGAC
AATGGAAGGCAGTGTGCTTTCGGAGACGGGTATAACACTACTGCGACAGTGTCCAACTCTGCGGGACAATCCCTC
GTAATTCATACCTTCCCCTATTACATCCAGAATGCAGTTGTTGCAATCCAGGCCAAAGGCGCAATCCCTATAATT
TCTTCGCAAACCCCTAGCAATGACTGGTCCAATGGTCGCATAGTCGCAGGGCCTCGGTTTGTGGGATACGCACAA
ACTGCGGCAAATCGTACAGGCGCCACATATGTTGACCATTATGCTTATGTTGCACAAGCATACAACAAACTTGGA
CAGACCGCTACGACAGCTTTCTACCCGGGAGACCATACACACACATCACCTGCAGGCGCGAATGTGGTCGCGCAG
GCTTTCATGAGAGGGATACTGTGCGGAAATAGCTCGCTGAAATCGAAGGCCAACTCAGCTGGTCAGTCTGTCCCA
AATGGGTGTCTGTAG
Gene >Agabi119p4|559150
ATGGCCCGCGGTGGAGGAGGCTCTGCCGCACCTGGGACAGATGGTAAGTAAGTTCTGGAATGGAATACACACAAT
CAGTACTTATATTCTAAAGGCTGGGGACAGTACCTGGGACAGTATCTAACAGTTCCTGTCGTCAATCGCGCTATT
GCTGGCCGGTCTTCGAGATCATATACTGACGAGGGGCGCTTTGATGCTCTCTTGAATACAGTGAGACCGGGTGAC
TTTGTAATTATCGAATTTGGCCATAACGATGGGATGTCTGGAAATGTCGACAATGGAAGGCAGTGTGCTTTCGGA
GACGGGTATAACACTACTGCGACAGTGTCCAACTCTGCGTGAGTTTTTTGCTGTACGCGTGAAAAATATGACGGG
CTGAAATTTTGCAAGGGGACAATCCCTCGTAATTCATACCTTCCCCTATTACATCCAGAATGCAGTTGTTGCAAT
CCAGGCCAAAGGCGCAATCCCTATAATTTCTTCGCAAACCCCTAGCAATGACTGGTCCAATGGTCGCATAGTCGC
AGGGCCTCGGTTTGTGGGATACGCACAAACTGCGGCAAATCGTACAGGCGCCACATATGTTGACCATTATGCTTA
TGTTGCACAAGCATACAACAAACTTGGACAGACCGCTACGACAGCTTTCTACCCGGGAGACCATACACACACATC
ACCTGCAGGCGCGAATGTGGTCGCGCAGGCTTTCATGAGAGGGATACTGTGCGGAAATAGCTCGCTGAAATCGAA
GGCCAACTCAGCTGGTCAGTCTGTCCCAAGTAAGTGGAAATCGAGTACCCTGCACAGATGGATCTGAATATCTTG
CCAGATGGGTGTCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail