Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|558900
Gene name
Locationscaffold_01a:882391..884138
Strand-
Gene length (bp)1747
Transcript length (bp)1452
Coding sequence length (bp)1452
Protein length (aa) 484

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12542 CWC25 Pre-mRNA splicing factor 2.4E-23 65 155
PF10197 Cir_N N-terminal domain of CBF1 interacting co-repressor CIR 7.9E-14 11 47

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y805|CWC25_SCHPO Pre-mRNA-splicing factor cwf25 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf25 PE=1 SV=1 1 421 8.0E-56
sp|P0CM98|CWC25_CRYNJ Pre-mRNA-splicing factor CWC25 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CWC25 PE=3 SV=1 1 396 5.0E-55
sp|P0CM99|CWC25_CRYNB Pre-mRNA-splicing factor CWC25 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CWC25 PE=3 SV=1 1 396 5.0E-55
sp|Q4P6I3|CWC25_USTMA Pre-mRNA-splicing factor CWC25 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CWC25 PE=3 SV=2 1 175 2.0E-53
sp|Q4IRI9|CWC25_GIBZE Pre-mRNA-splicing factor CWC25 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CWC25 PE=3 SV=1 1 182 1.0E-47
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y805|CWC25_SCHPO Pre-mRNA-splicing factor cwf25 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf25 PE=1 SV=1 1 421 8.0E-56
sp|P0CM98|CWC25_CRYNJ Pre-mRNA-splicing factor CWC25 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CWC25 PE=3 SV=1 1 396 5.0E-55
sp|P0CM99|CWC25_CRYNB Pre-mRNA-splicing factor CWC25 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CWC25 PE=3 SV=1 1 396 5.0E-55
sp|Q4P6I3|CWC25_USTMA Pre-mRNA-splicing factor CWC25 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CWC25 PE=3 SV=2 1 175 2.0E-53
sp|Q4IRI9|CWC25_GIBZE Pre-mRNA-splicing factor CWC25 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CWC25 PE=3 SV=1 1 182 1.0E-47
sp|Q5B0I1|CWC25_EMENI Pre-mRNA-splicing factor cwc25 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cwc25 PE=3 SV=1 3 152 5.0E-41
sp|Q4X1D7|CWC25_ASPFU Pre-mRNA-splicing factor cwc25 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cwc25 PE=3 SV=1 3 157 6.0E-32
sp|Q7SI59|CWC25_NEUCR Pre-mRNA-splicing factor cwc25 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=msp-6 PE=3 SV=1 1 157 1.0E-28
sp|Q6C1V6|CWC25_YARLI Pre-mRNA-splicing factor CWC25 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CWC25 PE=3 SV=1 4 143 1.0E-24
sp|Q9DBF7|CWC25_MOUSE Pre-mRNA-splicing factor CWC25 homolog OS=Mus musculus GN=Cwc25 PE=2 SV=2 1 163 6.0E-19
sp|Q9NXE8|CWC25_HUMAN Pre-mRNA-splicing factor CWC25 homolog OS=Homo sapiens GN=CWC25 PE=1 SV=1 1 163 8.0E-19
sp|Q6BNE1|CWC25_DEBHA Pre-mRNA-splicing factor CWC25 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CWC25 PE=3 SV=2 4 151 6.0E-17
sp|Q6CUQ5|CWC25_KLULA Pre-mRNA-splicing factor CWC25 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CWC25 PE=3 SV=1 5 101 4.0E-14
sp|P53854|CWC25_YEAST Pre-mRNA-splicing factor CWC25 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CWC25 PE=1 SV=1 1 98 4.0E-13
sp|Q6FP02|CWC25_CANGA Pre-mRNA-splicing factor CWC25 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CWC25 PE=3 SV=1 1 179 2.0E-11
sp|Q59LQ5|CWC25_CANAL Pre-mRNA-splicing factor CWC25 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CWC25 PE=3 SV=1 4 211 1.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|558900
MGGGDLNMKKSWHPLLLKNQERVWLEEKKALEEKKKLDQLRKEKEEERQLQELQRLQEEQTGKKRQEKLEWMYST
PATGNSQNPNDLEDYLLGKKRVDKMLTADENAKLGASHRNFIAVQNANTVRDISAKIREDPLLAIKQQEQAAYQA
LLANPLRLWAMQERNGIKPEKDKKERKREKEERKRLKAERKYRRERSSRSLSPHERRRSRSRSPYESRRSPSPYS
RRSRSRDRDYYRPPPYNDRRDRPSRQYSPEPRRAGNSRNIERDDRGRDRARNHGSSSSAYHRSRSPQYANGRRER
NSSPAFRPPRHHSDPIPPLRSRTPPRQASTAEKDTKTSAEERAARLAAMTSNASSMQDERKKRLAELLEQEKAEL
AREEEQRAKSAKSGGVGKFMSADYKKVYSGEGGLEDRLRRARGTLVVDYLVLFNFHSVNSLFSSTLAMPPRRAPS
VPSVVSRAPSPVFEEDDTPFFDSVDELQQHARH*
Coding >Agabi119p4|558900
ATGGGTGGCGGAGACTTGAACATGAAAAAGTCTTGGCACCCGCTCCTGTTGAAGAATCAGGAGCGGGTTTGGCTC
GAGGAAAAGAAAGCGCTCGAAGAGAAAAAGAAACTTGACCAGCTTCGAAAGGAGAAGGAGGAAGAGCGTCAGCTA
CAGGAGCTTCAGCGACTGCAGGAAGAACAAACTGGGAAGAAACGGCAGGAAAAACTGGAATGGATGTATTCAACA
CCAGCGACGGGGAATAGTCAAAATCCTAACGATCTGGAGGATTATCTGCTGGGGAAAAAGAGAGTCGATAAAATG
CTCACTGCAGATGAAAATGCCAAGTTGGGTGCGTCCCACAGAAACTTTATCGCAGTCCAAAATGCCAACACGGTC
CGCGATATTTCGGCCAAGATTCGAGAAGATCCATTGCTCGCCATAAAACAGCAGGAGCAGGCTGCATACCAAGCT
CTCCTCGCCAACCCCTTACGCCTGTGGGCAATGCAGGAGAGAAATGGTATCAAGCCAGAGAAAGATAAGAAGGAG
CGGAAAAGAGAGAAGGAAGAGCGTAAGAGGCTCAAGGCCGAGCGAAAATATCGTCGTGAAAGGAGTTCACGATCG
CTAAGCCCCCACGAGCGAAGACGCTCACGTTCACGAAGCCCTTACGAGTCAAGGCGGTCGCCCAGCCCTTATTCT
CGACGGTCGAGGAGTCGCGACAGGGATTACTATCGTCCACCTCCCTATAATGACCGCAGGGATCGACCATCCAGA
CAGTACAGCCCGGAACCGCGTCGGGCAGGTAATAGCCGCAACATTGAACGCGACGACAGAGGGAGAGATCGCGCG
AGGAATCATGGGTCCTCGTCAAGCGCCTATCATCGGAGTAGAAGCCCCCAATACGCCAATGGCAGGCGCGAGAGG
AATTCGAGTCCTGCCTTCCGCCCACCACGCCATCATTCAGACCCTATTCCTCCTCTTCGGTCTCGTACACCTCCT
CGTCAAGCTAGTACGGCCGAAAAGGATACAAAGACTTCTGCAGAAGAACGAGCTGCGCGCTTGGCCGCTATGACT
TCCAACGCCTCAAGCATGCAAGACGAGCGCAAGAAGCGATTGGCAGAGTTATTGGAACAAGAAAAGGCGGAATTA
GCAAGGGAGGAAGAGCAACGTGCTAAATCTGCCAAGTCTGGTGGTGTCGGAAAATTCATGAGTGCAGACTACAAG
AAGGTGTACAGTGGTGAAGGGGGATTGGAAGACCGCCTCCGGAGAGCTCGGGGTACTTTGGTTGTCGACTATCTG
GTTCTATTTAACTTTCATTCCGTCAACTCTCTTTTTTCTTCCACCCTCGCAATGCCACCACGTCGTGCGCCCTCT
GTTCCGTCGGTTGTCTCGCGTGCTCCCAGCCCTGTGTTTGAAGAAGACGATACACCATTCTTCGACTCCGTTGAT
GAGCTTCAGCAACATGCAAGGCACTAG
Transcript >Agabi119p4|558900
ATGGGTGGCGGAGACTTGAACATGAAAAAGTCTTGGCACCCGCTCCTGTTGAAGAATCAGGAGCGGGTTTGGCTC
GAGGAAAAGAAAGCGCTCGAAGAGAAAAAGAAACTTGACCAGCTTCGAAAGGAGAAGGAGGAAGAGCGTCAGCTA
CAGGAGCTTCAGCGACTGCAGGAAGAACAAACTGGGAAGAAACGGCAGGAAAAACTGGAATGGATGTATTCAACA
CCAGCGACGGGGAATAGTCAAAATCCTAACGATCTGGAGGATTATCTGCTGGGGAAAAAGAGAGTCGATAAAATG
CTCACTGCAGATGAAAATGCCAAGTTGGGTGCGTCCCACAGAAACTTTATCGCAGTCCAAAATGCCAACACGGTC
CGCGATATTTCGGCCAAGATTCGAGAAGATCCATTGCTCGCCATAAAACAGCAGGAGCAGGCTGCATACCAAGCT
CTCCTCGCCAACCCCTTACGCCTGTGGGCAATGCAGGAGAGAAATGGTATCAAGCCAGAGAAAGATAAGAAGGAG
CGGAAAAGAGAGAAGGAAGAGCGTAAGAGGCTCAAGGCCGAGCGAAAATATCGTCGTGAAAGGAGTTCACGATCG
CTAAGCCCCCACGAGCGAAGACGCTCACGTTCACGAAGCCCTTACGAGTCAAGGCGGTCGCCCAGCCCTTATTCT
CGACGGTCGAGGAGTCGCGACAGGGATTACTATCGTCCACCTCCCTATAATGACCGCAGGGATCGACCATCCAGA
CAGTACAGCCCGGAACCGCGTCGGGCAGGTAATAGCCGCAACATTGAACGCGACGACAGAGGGAGAGATCGCGCG
AGGAATCATGGGTCCTCGTCAAGCGCCTATCATCGGAGTAGAAGCCCCCAATACGCCAATGGCAGGCGCGAGAGG
AATTCGAGTCCTGCCTTCCGCCCACCACGCCATCATTCAGACCCTATTCCTCCTCTTCGGTCTCGTACACCTCCT
CGTCAAGCTAGTACGGCCGAAAAGGATACAAAGACTTCTGCAGAAGAACGAGCTGCGCGCTTGGCCGCTATGACT
TCCAACGCCTCAAGCATGCAAGACGAGCGCAAGAAGCGATTGGCAGAGTTATTGGAACAAGAAAAGGCGGAATTA
GCAAGGGAGGAAGAGCAACGTGCTAAATCTGCCAAGTCTGGTGGTGTCGGAAAATTCATGAGTGCAGACTACAAG
AAGGTGTACAGTGGTGAAGGGGGATTGGAAGACCGCCTCCGGAGAGCTCGGGGTACTTTGGTTGTCGACTATCTG
GTTCTATTTAACTTTCATTCCGTCAACTCTCTTTTTTCTTCCACCCTCGCAATGCCACCACGTCGTGCGCCCTCT
GTTCCGTCGGTTGTCTCGCGTGCTCCCAGCCCTGTGTTTGAAGAAGACGATACACCATTCTTCGACTCCGTTGAT
GAGCTTCAGCAACATGCAAGGCACTAG
Gene >Agabi119p4|558900
ATGGGTGGCGGAGACTTGAACATGAAAAAGTCTTGGCACCCGCTCCTGTTGAAGAATCAGGAGCGGGTTTGGCTC
GAGGAAAAGAAAGCGGTAAATATCCAGCCTCAGTCATCCCGCAACTCTCGCTAACTCCATCGCACAGCTCGAAGA
GAAAAAGAAACTTGACCAGCTTCGAAAGGAGAAGGAGGAAGAGCGTCAGCTACAGGAGCTTCAGCGACTGCAGGA
AGAACAAACTGGGAAGAAACGGCAGGAAAAACTGGAATGGATGTATTCAACACCAGCGACGGGGAATAGTCAAAA
TCCTAACGATCTGGAGGATTATCTGCTGGGGAAAAAGAGAGTCGATAAAATGCTCACTGCAGATGAAAATGCCAA
GGTGCGTGTCGAACATCTTCGACCATGATATGACTTCCCTTACCTTATGATCCAGTTGGGTGCGTCCCACAGAAA
CTTTATCGCAGTCCAAAATGCCAACACGGTCCGCGATATTTCGGCCAAGATTCGAGAAGATCCATTGCTCGCCAT
AAAACAGCAGGAGCAGGCTGCATACCAAGCTCTCCTCGCCAACCCCTTACGCCTGTGGGCAATGCAGGAGAGAAA
TGGTATCAAGCCAGAGAAAGATAAGAAGGAGCGGAAAAGAGAGAAGGAAGAGCGTAAGAGGCTCAAGGCCGAGCG
AAAATATCGTCGTGAAAGGAGTTCACGATCGCTAAGCCCCCACGAGCGAAGACGCTCACGTTCACGAAGCCCTTA
CGAGTCAAGGCGGTCGCCCAGCCCTTATTCTCGACGGTCGAGGAGTCGCGACAGGGATTACTATCGTCCACCTCC
CTATAATGACCGCAGGGATCGACCATCCAGACAGTACAGCCCGGAACCGCGTCGGGCAGGTAATAGCCGCAACAT
TGAACGCGACGACAGAGGGAGAGATCGCGCGAGGAATCATGGGTCCTCGTCAAGCGCCTATCATCGGAGTAGAAG
CCCCCAATACGCCAATGGCAGGCGCGAGAGGAATTCGAGTCCTGCCTTCCGCCCACCACGCCATCATTCAGACCC
TATTCCTCCTCTTCGGTCTCGTACACCTCCTCGTCAAGCTAGTACGGCCGAAAAGGATACAAAGACTTCTGCAGA
AGAACGAGCTGCGCGCTTGGCCGCTATGACTTCCAACGCCTCAAGCATGCAAGACGAGCGCAAGAAGCGATTGGC
AGAGTTATTGGAACAAGAAAAGGCGGAATTAGCAAGGGAGGAAGAGCAACGTGCTAAATCTGCCAAGTCTGGTGG
TGTCGGAAAATTCATGAGTGCAGACTACAAGAAGGTGTACAGTGGTGAAGGGGGATTGGAAGACCGCCTCCGGAG
AGCTCGGGGTACTTTGGTTGTCGACTAGTATGTTTCTTTTTCGAACTCTGTGTTACGATCGCATGCGTGCAATTT
GTTCGTCACCTCTCTTGTATTATATAGGGTCGCCGTTTATCGCTGTAATGTCGCGTACCGTTGGATATATGCGCT
CACGTGTGTTAAAGTCTGGTTCTATTTAACTTTCATTCCGTCAACTCTCTTTTTTCTTCCACCCTCGCAATGCCA
CCACGTCGTGCGCCCTCTGTTCCGTCGGTTGTCTCGCGTGCTCCCAGCCCTGTGTTTGAAGAAGACGATGTGAGC
TTCTGCGCGTTGCCTAATACTCTGAACTCGATCTTGTTTTCTTTAGACACCATTCTTCGACTCCGTTGATGAGCT
TCAGCAACATGCAAGGCACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail