Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|558550
Gene name
Locationscaffold_01a:759589..760173
Strand+
Gene length (bp)584
Transcript length (bp)369
Coding sequence length (bp)369
Protein length (aa) 123

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 4.3E-09 5 103

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q42479|CDPK3_ARATH Calcium-dependent protein kinase 3 OS=Arabidopsis thaliana GN=CPK3 PE=1 SV=1 5 106 4.0E-10
sp|P62343|CDPK1_PLAFK Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK1 PE=1 SV=2 9 121 2.0E-09
sp|P62344|CDPK1_PLAF7 Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate 3D7) GN=CPK1 PE=3 SV=2 9 121 2.0E-09
sp|Q7RAH3|CDPK1_PLAYO Calcium-dependent protein kinase 1 OS=Plasmodium yoelii yoelii GN=CPK1 PE=3 SV=3 9 121 2.0E-09
sp|Q06850|CDPK1_ARATH Calcium-dependent protein kinase 1 OS=Arabidopsis thaliana GN=CPK1 PE=1 SV=1 5 106 3.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q42479|CDPK3_ARATH Calcium-dependent protein kinase 3 OS=Arabidopsis thaliana GN=CPK3 PE=1 SV=1 5 106 4.0E-10
sp|P62343|CDPK1_PLAFK Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK1 PE=1 SV=2 9 121 2.0E-09
sp|P62344|CDPK1_PLAF7 Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate 3D7) GN=CPK1 PE=3 SV=2 9 121 2.0E-09
sp|Q7RAH3|CDPK1_PLAYO Calcium-dependent protein kinase 1 OS=Plasmodium yoelii yoelii GN=CPK1 PE=3 SV=3 9 121 2.0E-09
sp|Q06850|CDPK1_ARATH Calcium-dependent protein kinase 1 OS=Arabidopsis thaliana GN=CPK1 PE=1 SV=1 5 106 3.0E-09
sp|Q38870|CDPK2_ARATH Calcium-dependent protein kinase 2 OS=Arabidopsis thaliana GN=CPK2 PE=1 SV=1 5 106 3.0E-09
sp|Q66JF3|MKNK1_XENTR MAP kinase-interacting serine/threonine-protein kinase 1 OS=Xenopus tropicalis GN=mknk1 PE=2 SV=1 9 106 9.0E-09
sp|Q8GVC7|PKZ1_PHYIN Serine/threonine-protein kinase PKZ1 OS=Phytophthora infestans GN=PKZ1 PE=1 SV=1 9 116 2.0E-08
sp|Q9LEU7|CIPK5_ARATH CBL-interacting serine/threonine-protein kinase 5 OS=Arabidopsis thaliana GN=CIPK5 PE=2 SV=1 3 106 2.0E-08
sp|Q7SY49|CAMKV_DANRE CaM kinase-like vesicle-associated protein OS=Danio rerio GN=camkv PE=2 SV=2 5 106 2.0E-08
sp|Q43531|CCAMK_LILLO Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Lilium longiflorum GN=CCAMK PE=1 SV=1 4 106 3.0E-08
sp|Q9SPK4|PPCK1_ARATH Phosphoenolpyruvate carboxylase kinase 1 OS=Arabidopsis thaliana GN=PPCK1 PE=1 SV=1 5 104 5.0E-08
sp|D0N4E2|PKZ1_PHYIT Serine/threonine-protein kinase PKZ1 OS=Phytophthora infestans (strain T30-4) GN=PKZ1 PE=3 SV=1 9 116 5.0E-08
sp|Q62915|CSKP_RAT Peripheral plasma membrane protein CASK OS=Rattus norvegicus GN=Cask PE=1 SV=1 5 122 5.0E-08
sp|O70589|CSKP_MOUSE Peripheral plasma membrane protein CASK OS=Mus musculus GN=Cask PE=1 SV=2 5 122 5.0E-08
sp|O14936|CSKP_HUMAN Peripheral plasma membrane protein CASK OS=Homo sapiens GN=CASK PE=1 SV=3 5 122 5.0E-08
sp|Q54VI1|FHKE_DICDI Probable serine/threonine-protein kinase fhkE OS=Dictyostelium discoideum GN=fhkE PE=3 SV=1 5 108 7.0E-08
sp|P52497|SNF1_CANAX Carbon catabolite-derepressing protein kinase OS=Candida albicans GN=SNF1 PE=2 SV=2 3 107 7.0E-08
sp|P28582|CDPK_DAUCA Calcium-dependent protein kinase OS=Daucus carota PE=2 SV=2 5 104 8.0E-08
sp|P34101|FHKC_DICDI Probable serine/threonine-protein kinase fhkC OS=Dictyostelium discoideum GN=fhkC PE=3 SV=2 5 116 1.0E-07
sp|Q9Z265|CHK2_MOUSE Serine/threonine-protein kinase Chk2 OS=Mus musculus GN=Chek2 PE=1 SV=1 9 119 1.0E-07
sp|Q9YGM4|CAMKV_TAKRU CaM kinase-like vesicle-associated protein OS=Takifugu rubripes GN=camkv PE=2 SV=1 5 106 1.0E-07
sp|Q8W4I7|CDPKD_ARATH Calcium-dependent protein kinase 13 OS=Arabidopsis thaliana GN=CPK13 PE=1 SV=2 5 105 1.0E-07
sp|Q6GLS4|CAMKV_XENLA CaM kinase-like vesicle-associated protein OS=Xenopus laevis GN=camkv PE=2 SV=1 5 106 1.0E-07
sp|Q9ZSA2|CDPKL_ARATH Calcium-dependent protein kinase 21 OS=Arabidopsis thaliana GN=CPK21 PE=1 SV=1 5 104 2.0E-07
sp|Q1PFH8|CDPKJ_ARATH Calcium-dependent protein kinase 19 OS=Arabidopsis thaliana GN=CPK19 PE=2 SV=1 5 104 2.0E-07
sp|Q2V452|CIPK3_ARATH CBL-interacting serine/threonine-protein kinase 3 OS=Arabidopsis thaliana GN=CIPK3 PE=1 SV=2 3 106 2.0E-07
sp|P22987|KIN1_SCHPO Protein kinase kin1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kin1 PE=1 SV=3 3 103 2.0E-07
sp|Q58D94|MKNK1_BOVIN MAP kinase-interacting serine/threonine-protein kinase 1 OS=Bos taurus GN=MKNK1 PE=2 SV=2 9 104 2.0E-07
sp|P93759|CDPKE_ARATH Calcium-dependent protein kinase 14 OS=Arabidopsis thaliana GN=CPK14 PE=2 SV=1 5 113 2.0E-07
sp|P28583|CDPK_SOYBN Calcium-dependent protein kinase SK5 OS=Glycine max PE=1 SV=1 5 106 2.0E-07
sp|Q8RWL2|CDPKT_ARATH Calcium-dependent protein kinase 29 OS=Arabidopsis thaliana GN=CPK29 PE=2 SV=2 5 103 3.0E-07
sp|Q6AVM3|CCAMK_ORYSJ Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Oryza sativa subsp. japonica GN=CCAMK PE=2 SV=1 4 106 3.0E-07
sp|Q9SSF8|CDPKU_ARATH Calcium-dependent protein kinase 30 OS=Arabidopsis thaliana GN=CPK30 PE=1 SV=1 5 105 3.0E-07
sp|Q6NLQ6|CDPKW_ARATH Calcium-dependent protein kinase 32 OS=Arabidopsis thaliana GN=CPK32 PE=1 SV=1 5 105 3.0E-07
sp|O08605|MKNK1_MOUSE MAP kinase-interacting serine/threonine-protein kinase 1 OS=Mus musculus GN=Mknk1 PE=1 SV=2 9 104 3.0E-07
sp|O49717|CDPKF_ARATH Calcium-dependent protein kinase 15 OS=Arabidopsis thaliana GN=CPK15 PE=2 SV=1 5 104 3.0E-07
sp|Q9ZV15|CDPKK_ARATH Calcium-dependent protein kinase 20 OS=Arabidopsis thaliana GN=CPK20 PE=3 SV=1 9 106 3.0E-07
sp|Q9C6P3|CDPKX_ARATH Calcium-dependent protein kinase 33 OS=Arabidopsis thaliana GN=CPK33 PE=2 SV=1 5 104 3.0E-07
sp|Q9YGW0|MKNK1_XENLA MAP kinase-interacting serine/threonine-protein kinase 1 OS=Xenopus laevis GN=mknk1 PE=2 SV=2 9 106 4.0E-07
sp|Q63092|CAMKV_RAT CaM kinase-like vesicle-associated protein OS=Rattus norvegicus GN=Camkv PE=1 SV=1 5 106 5.0E-07
sp|Q3UHL1|CAMKV_MOUSE CaM kinase-like vesicle-associated protein OS=Mus musculus GN=Camkv PE=1 SV=2 5 106 5.0E-07
sp|P25323|MYLKA_DICDI Myosin light chain kinase A OS=Dictyostelium discoideum GN=mlkA PE=1 SV=2 8 106 5.0E-07
sp|Q8NCB2|CAMKV_HUMAN CaM kinase-like vesicle-associated protein OS=Homo sapiens GN=CAMKV PE=2 SV=2 5 106 5.0E-07
sp|Q5MPA9|DCLK2_RAT Serine/threonine-protein kinase DCLK2 OS=Rattus norvegicus GN=Dclk2 PE=1 SV=2 5 109 5.0E-07
sp|O94168|SNF1_CANTR Carbon catabolite-derepressing protein kinase OS=Candida tropicalis GN=SNF1 PE=3 SV=1 3 107 6.0E-07
sp|Q9SIQ7|CDPKO_ARATH Calcium-dependent protein kinase 24 OS=Arabidopsis thaliana GN=CPK24 PE=2 SV=1 5 105 6.0E-07
sp|Q6PGN3|DCLK2_MOUSE Serine/threonine-protein kinase DCLK2 OS=Mus musculus GN=Dclk2 PE=1 SV=1 5 109 7.0E-07
sp|P15791|KCC2D_RAT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Rattus norvegicus GN=Camk2d PE=1 SV=1 5 103 8.0E-07
sp|Q9FMP5|CDPKH_ARATH Calcium-dependent protein kinase 17 OS=Arabidopsis thaliana GN=CPK17 PE=2 SV=1 5 106 8.0E-07
sp|Q2HJF7|KCC2D_BOVIN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Bos taurus GN=CAMK2D PE=2 SV=1 5 103 8.0E-07
sp|Q95266|KCC2D_PIG Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Sus scrofa GN=CAMK2D PE=2 SV=1 5 103 8.0E-07
sp|O77708|KCC2D_RABIT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Oryctolagus cuniculus GN=CAMK2D PE=2 SV=2 5 103 8.0E-07
sp|Q13555|KCC2G_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Homo sapiens GN=CAMK2G PE=1 SV=3 5 121 8.0E-07
sp|Q6PHZ2|KCC2D_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Mus musculus GN=Camk2d PE=1 SV=1 5 103 8.0E-07
sp|Q13557|KCC2D_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Homo sapiens GN=CAMK2D PE=1 SV=3 5 103 8.0E-07
sp|Q5ZKI0|KCC2D_CHICK Calcium/calmodulin-dependent protein kinase type II delta chain OS=Gallus gallus GN=CAMK2D PE=2 SV=1 5 103 9.0E-07
sp|Q96QS6|KPSH2_HUMAN Serine/threonine-protein kinase H2 OS=Homo sapiens GN=PSKH2 PE=2 SV=1 9 103 9.0E-07
sp|Q923T9|KCC2G_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Mus musculus GN=Camk2g PE=1 SV=1 5 121 9.0E-07
sp|P24719|MEK1_YEAST Meiosis-specific serine/threonine-protein kinase MEK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MEK1 PE=3 SV=1 9 118 9.0E-07
sp|P53683|CDPK2_ORYSJ Calcium-dependent protein kinase isoform 2 OS=Oryza sativa subsp. japonica GN=CPK2 PE=2 SV=2 5 104 9.0E-07
sp|D2I3C6|DCLK2_AILME Serine/threonine-protein kinase DCLK2 OS=Ailuropoda melanoleuca GN=DCLK2 PE=3 SV=1 5 109 9.0E-07
sp|Q8N568|DCLK2_HUMAN Serine/threonine-protein kinase DCLK2 OS=Homo sapiens GN=DCLK2 PE=2 SV=4 5 109 9.0E-07
sp|P08413|KCC2B_RAT Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Rattus norvegicus GN=Camk2b PE=1 SV=1 5 103 9.0E-07
sp|P28652|KCC2B_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Mus musculus GN=Camk2b PE=1 SV=2 5 103 9.0E-07
sp|P11730|KCC2G_RAT Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Rattus norvegicus GN=Camk2g PE=1 SV=1 5 121 1.0E-06
sp|P49101|CDPK2_MAIZE Calcium-dependent protein kinase 2 OS=Zea mays GN=CPK2 PE=2 SV=1 5 104 1.0E-06
sp|Q2QY53|CIPKW_ORYSJ CBL-interacting protein kinase 32 OS=Oryza sativa subsp. japonica GN=CIPK32 PE=2 SV=2 3 104 1.0E-06
sp|Q6DEH3|KC2D1_DANRE Calcium/calmodulin-dependent protein kinase type II delta 1 chain OS=Danio rerio GN=camk2d1 PE=2 SV=2 5 103 1.0E-06
sp|Q3E9C0|CDPKY_ARATH Calcium-dependent protein kinase 34 OS=Arabidopsis thaliana GN=CPK34 PE=2 SV=1 5 106 2.0E-06
sp|O15075|DCLK1_HUMAN Serine/threonine-protein kinase DCLK1 OS=Homo sapiens GN=DCLK1 PE=1 SV=2 5 106 2.0E-06
sp|A0AAR7|CCAMK_LOTJA Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Lotus japonicus GN=CCAMK PE=1 SV=1 4 106 2.0E-06
sp|Q14012|KCC1A_HUMAN Calcium/calmodulin-dependent protein kinase type 1 OS=Homo sapiens GN=CAMK1 PE=1 SV=1 9 106 2.0E-06
sp|Q63450|KCC1A_RAT Calcium/calmodulin-dependent protein kinase type 1 OS=Rattus norvegicus GN=Camk1 PE=1 SV=2 9 106 2.0E-06
sp|Q91YS8|KCC1A_MOUSE Calcium/calmodulin-dependent protein kinase type 1 OS=Mus musculus GN=Camk1 PE=1 SV=1 9 106 2.0E-06
sp|Q9BUB5|MKNK1_HUMAN MAP kinase-interacting serine/threonine-protein kinase 1 OS=Homo sapiens GN=MKNK1 PE=1 SV=1 9 104 2.0E-06
sp|Q4G050|MKNK1_RAT MAP kinase-interacting serine/threonine-protein kinase 1 OS=Rattus norvegicus GN=Mknk1 PE=2 SV=1 9 104 2.0E-06
sp|Q3SYZ2|MAPK3_BOVIN MAP kinase-activated protein kinase 3 OS=Bos taurus GN=MAPKAPK3 PE=2 SV=1 8 107 2.0E-06
sp|Q2RAX3|CIPKX_ORYSJ CBL-interacting protein kinase 33 OS=Oryza sativa subsp. japonica GN=CIPK33 PE=2 SV=1 3 104 2.0E-06
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 9 103 2.0E-06
sp|Q6RET6|CCAMK_PEA Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase (Fragment) OS=Pisum sativum GN=SYM9 PE=1 SV=2 4 106 2.0E-06
sp|Q38868|CDPK9_ARATH Calcium-dependent protein kinase 9 OS=Arabidopsis thaliana GN=CPK9 PE=1 SV=1 5 104 2.0E-06
sp|Q84VQ3|CIPKQ_ARATH CBL-interacting serine/threonine-protein kinase 26 OS=Arabidopsis thaliana GN=CIPK26 PE=1 SV=2 3 106 2.0E-06
sp|Q13554|KCC2B_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Homo sapiens GN=CAMK2B PE=1 SV=3 5 103 2.0E-06
sp|Q9C098|DCLK3_HUMAN Serine/threonine-protein kinase DCLK3 OS=Homo sapiens GN=DCLK3 PE=2 SV=2 5 122 2.0E-06
sp|Q5RCC4|KCC2A_PONAB Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Pongo abelii GN=CAMK2A PE=2 SV=2 5 103 3.0E-06
sp|Q9UQM7|KCC2A_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Homo sapiens GN=CAMK2A PE=1 SV=2 5 103 3.0E-06
sp|Q42396|CDPKC_ARATH Calcium-dependent protein kinase 12 OS=Arabidopsis thaliana GN=CPK12 PE=1 SV=1 3 106 3.0E-06
sp|P11275|KCC2A_RAT Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Rattus norvegicus GN=Camk2a PE=1 SV=1 5 103 3.0E-06
sp|P11798|KCC2A_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Mus musculus GN=Camk2a PE=1 SV=2 5 103 3.0E-06
sp|Q16644|MAPK3_HUMAN MAP kinase-activated protein kinase 3 OS=Homo sapiens GN=MAPKAPK3 PE=1 SV=1 8 107 3.0E-06
sp|P13186|KIN2_YEAST Serine/threonine-protein kinase KIN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN2 PE=1 SV=3 3 103 3.0E-06
sp|Q38869|CDPK4_ARATH Calcium-dependent protein kinase 4 OS=Arabidopsis thaliana GN=CPK4 PE=1 SV=1 5 103 3.0E-06
sp|Q66H84|MAPK3_RAT MAP kinase-activated protein kinase 3 OS=Rattus norvegicus GN=Mapkapk3 PE=2 SV=1 9 108 4.0E-06
sp|Q8ICR0|CDPK2_PLAF7 Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate 3D7) GN=CPK2 PE=2 SV=3 9 103 4.0E-06
sp|O15865|CDPK2_PLAFK Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK2 PE=1 SV=3 9 103 4.0E-06
sp|O96017|CHK2_HUMAN Serine/threonine-protein kinase Chk2 OS=Homo sapiens GN=CHEK2 PE=1 SV=1 9 106 4.0E-06
sp|Q3MHJ9|KCC2B_BOVIN Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Bos taurus GN=CAMK2B PE=2 SV=1 5 103 4.0E-06
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 9 115 5.0E-06
sp|Q10SC8|CIPK9_ORYSJ CBL-interacting protein kinase 9 OS=Oryza sativa subsp. japonica GN=CIPK9 PE=2 SV=1 3 106 5.0E-06
sp|Q54MH0|FHKD_DICDI Probable serine/threonine-protein kinase fhkD OS=Dictyostelium discoideum GN=fhkD PE=3 SV=1 5 106 5.0E-06
sp|Q9DG02|KCC2D_XENLA Calcium/calmodulin-dependent protein kinase type II delta chain OS=Xenopus laevis GN=camk2d PE=2 SV=1 5 103 5.0E-06
sp|Q8W1D5|CIPKP_ARATH CBL-interacting serine/threonine-protein kinase 25 OS=Arabidopsis thaliana GN=CIPK25 PE=2 SV=1 3 107 5.0E-06
sp|Q93VK0|PPCK2_ARATH Phosphoenolpyruvate carboxylase kinase 2 OS=Arabidopsis thaliana GN=PPCK2 PE=1 SV=2 8 105 6.0E-06
sp|Q21017|KIN29_CAEEL Serine/threonine-protein kinase kin-29 OS=Caenorhabditis elegans GN=kin-29 PE=1 SV=2 3 109 6.0E-06
sp|Q9HFF4|PPK1_SCHPO Serine/threonine-protein kinase ppk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk1 PE=1 SV=2 3 107 6.0E-06
sp|Q9M9V8|CDPKA_ARATH Calcium-dependent protein kinase 10 OS=Arabidopsis thaliana GN=CPK10 PE=1 SV=1 5 105 6.0E-06
sp|P45894|AAPK1_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Caenorhabditis elegans GN=aak-1 PE=2 SV=2 3 107 7.0E-06
sp|Q5U2N4|MKNK2_RAT MAP kinase-interacting serine/threonine-protein kinase 2 OS=Rattus norvegicus GN=Mknk2 PE=2 SV=1 9 104 7.0E-06
sp|Q8CDB0|MKNK2_MOUSE MAP kinase-interacting serine/threonine-protein kinase 2 OS=Mus musculus GN=Mknk2 PE=1 SV=3 9 104 7.0E-06
sp|Q8IBS5|CDPK4_PLAF7 Calcium-dependent protein kinase 4 OS=Plasmodium falciparum (isolate 3D7) GN=CPK4 PE=1 SV=3 9 104 7.0E-06
sp|Q7RJG2|CDPK4_PLAYO Calcium-dependent protein kinase 4 OS=Plasmodium yoelii yoelii GN=CPK4 PE=3 SV=3 9 104 7.0E-06
sp|P62345|CDPK4_PLABA Calcium-dependent protein kinase 4 OS=Plasmodium berghei (strain Anka) GN=CPK4 PE=1 SV=2 9 104 7.0E-06
sp|Q8IU85|KCC1D_HUMAN Calcium/calmodulin-dependent protein kinase type 1D OS=Homo sapiens GN=CAMK1D PE=1 SV=1 9 106 7.0E-06
sp|Q39016|CDPKB_ARATH Calcium-dependent protein kinase 11 OS=Arabidopsis thaliana GN=CPK11 PE=1 SV=2 5 103 7.0E-06
sp|G4SLH0|TTN1_CAEEL Titin homolog OS=Caenorhabditis elegans GN=ttn-1 PE=1 SV=2 4 103 8.0E-06
sp|O54992|MAPK5_MOUSE MAP kinase-activated protein kinase 5 OS=Mus musculus GN=Mapkapk5 PE=1 SV=1 9 105 8.0E-06
sp|Q38997|KIN10_ARATH SNF1-related protein kinase catalytic subunit alpha KIN10 OS=Arabidopsis thaliana GN=KIN10 PE=1 SV=2 3 107 8.0E-06
sp|Q3UMW7|MAPK3_MOUSE MAP kinase-activated protein kinase 3 OS=Mus musculus GN=Mapkapk3 PE=1 SV=2 8 107 8.0E-06
sp|Q8BW96|KCC1D_MOUSE Calcium/calmodulin-dependent protein kinase type 1D OS=Mus musculus GN=Camk1d PE=1 SV=2 9 106 9.0E-06
sp|Q60670|SIK1_MOUSE Serine/threonine-protein kinase SIK1 OS=Mus musculus GN=Sik1 PE=1 SV=3 3 106 9.0E-06
sp|Q8IW41|MAPK5_HUMAN MAP kinase-activated protein kinase 5 OS=Homo sapiens GN=MAPKAPK5 PE=1 SV=2 9 105 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0006468 protein phosphorylation Yes
GO:0004672 protein kinase activity Yes
GO:0032559 adenyl ribonucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0019538 protein metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:0009987 cellular process No
GO:0006807 nitrogen compound metabolic process No
GO:0000166 nucleotide binding No
GO:0008152 metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:0016301 kinase activity No
GO:0016740 transferase activity No
GO:1901265 nucleoside phosphate binding No
GO:0016310 phosphorylation No
GO:1901564 organonitrogen compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0008150 biological_process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0036211 protein modification process No
GO:0017076 purine nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0044237 cellular metabolic process No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0043168 anion binding No
GO:0043412 macromolecule modification No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|558550
MWYIGMPADCWSAGVILYVMLAGCHPFDNEPTPQDSGDSSAHSNLSTGSRDTRLKERIVYGGINFPFHPWNGLSN
AKKLILELLIHDHLRRATVNTALNSDWIQSDIQQLRVSYRRRITGST*
Coding >Agabi119p4|558550
ATGTGGTATATTGGTATGCCTGCGGATTGCTGGAGTGCCGGTGTAATTCTCTACGTCATGCTCGCCGGTTGCCAT
CCCTTCGACAATGAGCCAACACCACAGGACTCAGGTGACTCGTCCGCCCACTCCAATCTCAGCACTGGGAGTAGG
GATACTCGATTGAAAGAACGAATCGTCTATGGTGGGATCAATTTTCCCTTTCACCCCTGGAATGGCCTTAGTAAC
GCAAAAAAACTCATTCTTGAGTTATTGATCCATGATCATCTCAGGCGGGCCACTGTCAATACTGCACTCAACAGC
GATTGGATTCAGAGCGATATCCAACAACTCAGAGTGTCGTACCGACGTAGAATAACGGGTAGTACATAA
Transcript >Agabi119p4|558550
ATGTGGTATATTGGTATGCCTGCGGATTGCTGGAGTGCCGGTGTAATTCTCTACGTCATGCTCGCCGGTTGCCAT
CCCTTCGACAATGAGCCAACACCACAGGACTCAGGTGACTCGTCCGCCCACTCCAATCTCAGCACTGGGAGTAGG
GATACTCGATTGAAAGAACGAATCGTCTATGGTGGGATCAATTTTCCCTTTCACCCCTGGAATGGCCTTAGTAAC
GCAAAAAAACTCATTCTTGAGTTATTGATCCATGATCATCTCAGGCGGGCCACTGTCAATACTGCACTCAACAGC
GATTGGATTCAGAGCGATATCCAACAACTCAGAGTGTCGTACCGACGTAGAATAACGGGTAGTACATAA
Gene >Agabi119p4|558550
ATGTGTGCGGAACGGTTTCTTACTTACCGCCTGAGGGGGTGCTCGCACTCGATCATAAACATCTAGGGTATATTG
GGTATGATTGGCGCCATCTAGCACTCTTTGCAAAGTTCTCAACCTCCTAGTATGCCTGCGGATTGCTGGAGTGCC
GGTGTAATTCTCTACGTCATGCTCGCGTGCGTGTACTGGCTGGTCAAGGAAGGAGTACATGCTAACCATAGCATA
AGCGGTTGCCATCCCTTCGACAATGAGCCAACACCACAGGACTCAGGTGACTCGTCCGCCCACTCCAATCTCAGC
ACTGGGAGTAGGGATACTCGATTGAAAGAACGAATCGTCTATGGTGGGATCAATTTTCCCTTTCACCCCTGGAAT
GGCCTTAGTAACGGTACGAGCAAAAAACCTTGCTTGGTATTCATAATTTACCCCGCTGATCTTAAGCAAAAAAAC
TCATTCTTGAGTTATTGATCCATGATCATCTCAGGCGGGCCACTGTCAATACTGCACTCAACAGCGATTGGATTC
AGAGCGATATCCAACAACTCAGAGTGTCGTACCGACGTAGAATAACGGGTAGTACATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail